BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0492 (511 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 181 3e-46 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 179 1e-45 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 1.4 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 29 1.8 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 29 1.8 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 3.2 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 4.2 At5g01010.1 68418.m00001 expressed protein 28 4.2 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 4.2 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 27 5.5 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 5.5 At4g04920.1 68417.m00715 expressed protein 27 7.3 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 27 7.3 At1g76010.1 68414.m08825 expressed protein 27 7.3 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 27 9.7 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 27 9.7 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 27 9.7 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 181 bits (440), Expect = 3e-46 Identities = 87/155 (56%), Positives = 102/155 (65%), Gaps = 2/155 (1%) Frame = +2 Query: 53 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 226 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 227 KEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXX 406 K+AGHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 61 KKAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRV 120 Query: 407 XXXXXXXXXXXXXXXXXXXXXXXXRGHIIEKIPEL 511 RGH IE +PE+ Sbjct: 121 NVNMKRHAIVSAIAATAVPALVMARGHKIENVPEM 155 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 179 bits (435), Expect = 1e-45 Identities = 87/152 (57%), Positives = 98/152 (64%), Gaps = 2/152 (1%) Frame = +2 Query: 62 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 235 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 236 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXX 415 GHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWH Sbjct: 65 GHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVN 124 Query: 416 XXXXXXXXXXXXXXXXXXXXXRGHIIEKIPEL 511 RGH IE +PE+ Sbjct: 125 MKRHAIVSAIAATAVPALVMARGHKIENVPEM 156 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 1.4 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +2 Query: 77 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 223 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 368 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 249 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 368 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 249 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 3.2 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +2 Query: 128 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 223 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 128 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 223 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 356 HHDTCYRRHPDRTYEYHHHGHAEF 285 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At5g01010.1 68418.m00001 expressed protein Length = 409 Score = 27.9 bits (59), Expect = 4.2 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -1 Query: 253 STGLVTSLLAHAVGLPRVLGHRNVNIIDQVR-TDGRLEHEREGLG 122 +TG+ +L+ + VG+P+VL ++ I Q+ DG +E +RE G Sbjct: 203 ATGVYKTLVKYLVGVPQVL----LDFIRQINDDDGPMEEQRERYG 243 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 131 GAWLHPAPSHSSLNTPTLKVGLPID--SFRYFSEAIPLKY 18 G W+H SH+ ++ L VG+ + Y+S + P++Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 27.5 bits (58), Expect = 5.5 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +2 Query: 221 VSKEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAPTKPW 385 + + G + +AE + + + ++P G G G+ G FGN GG F W Sbjct: 81 IRRRMGAKPTAEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGDISKW 138 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 5.5 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -3 Query: 356 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 273 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 >At4g04920.1 68417.m00715 expressed protein Length = 1250 Score = 27.1 bits (57), Expect = 7.3 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +2 Query: 146 KAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAE-SWGTGRAVARIPRVRGG 307 K P D + + +S S S VS EA Q++A +WG+G RGG Sbjct: 403 KKPSDQDSSDAISLSCSPVSNFSAYVSPEAAAQSAATTTWGSGVTAVAFDPTRGG 457 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 27.1 bits (57), Expect = 7.3 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +2 Query: 263 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 358 G GR R +GGG + G G+ G+ CR G Sbjct: 88 GGGRYQGGGGRYQGGGGRQGGGGSGGSYCRHG 119 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 27.1 bits (57), Expect = 7.3 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +2 Query: 224 SKEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG 355 S+ G + G GR R R RGGG R G G F N G Sbjct: 302 SQGRGGYDGPQGRGRGRGRGRGGRGRGGG--RGGDGGFNNRSDG 343 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 332 HPD-RTYEYHHHGHAEFGRQHVQYPMIQHWFGDQPP 228 HP + + Y H H + QH+ +P FG Q P Sbjct: 57 HPSMQQFPYQHPMHQQQQPQHLPHPPHPQMFGQQQP 92 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 332 HPD-RTYEYHHHGHAEFGRQHVQYPMIQHWFGDQPP 228 HP + + Y H H + QH+ +P FG Q P Sbjct: 57 HPSMQQFPYQHPMHQQQQPQHLPHPPHPQMFGQQQP 92 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 26.6 bits (56), Expect = 9.7 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 332 HPD-RTYEYHHHGHAEFGRQHVQYPMIQHWFGDQPP 228 HP + + Y H H + QH+ +P FG Q P Sbjct: 57 HPSMQQFPYQHPMHQQQQPQHLPHPPHPQMFGQQQP 92 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,995,645 Number of Sequences: 28952 Number of extensions: 200991 Number of successful extensions: 731 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 717 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 917929344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -