BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0488 (717 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 215 2e-56 SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_52239| Best HMM Match : Adaptin_N (HMM E-Value=9.9e-36) 29 2.8 SB_7863| Best HMM Match : Pentaxin (HMM E-Value=1.8) 29 2.8 SB_7325| Best HMM Match : SNF2_N (HMM E-Value=8.9e-32) 29 3.8 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_27592| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-39) 28 8.7 SB_11945| Best HMM Match : EURL (HMM E-Value=9.7) 28 8.7 >SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 215 bits (526), Expect = 2e-56 Identities = 117/226 (51%), Positives = 151/226 (66%), Gaps = 3/226 (1%) Frame = +2 Query: 47 RRDGKEED---SNVFQNLDKTTLLQEARYFNSTPVHPRKCIHILTKILYLLNQGEELTTQ 217 RRD K+E+ SN FQNLDK +LQEAR FN TP++ RKCIHILTKI Sbjct: 5 RRDKKDEEEGLSNPFQNLDKGQVLQEARVFNETPINVRKCIHILTKI------------- 51 Query: 218 EATDIFFATTKLFQSKDVVLRRLVYLCIKELSPMAQDVIIVTSSLTKDMTGKDDEYRPAA 397 L+ ++LRR+VYL IKEL+ +A+DVIIVTSSLTKDMTGK+D +R +A Sbjct: 52 -----------LYLINQLMLRRMVYLAIKELANIAEDVIIVTSSLTKDMTGKEDMFRASA 100 Query: 398 IRALCSITDSTMLQAIERYMKQAIVDKNPXXXXXXXXXXXXXXXXXPDLVRRWINEAQEA 577 IRALC ITD+TMLQ IERY+KQA+VDKNP D+V+RW+NEAQEA Sbjct: 101 IRALCRITDNTMLQGIERYLKQAVVDKNPSVSSAALVSSLHLLKPNFDVVKRWVNEAQEA 160 Query: 578 MTSDHVMVSYHALAVVAGARRNDRLSTVKLITKLARTPVRSPYTLC 715 ++SD+ MV YHAL ++ +++DRL+ KLI K ++ +RSPY +C Sbjct: 161 VSSDNTMVQYHALGLLYHIKQSDRLAVSKLIAKHSKHSLRSPYAVC 206 >SB_22143| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1995 Score = 29.9 bits (64), Expect = 2.2 Identities = 23/92 (25%), Positives = 44/92 (47%), Gaps = 4/92 (4%) Frame = +2 Query: 62 EEDSNVFQNLDKTTLLQEARYFNSTPVHPRKCIHILTKILYLLNQGE-ELTTQEATD-IF 235 E + Q+LD R+F++ KC+ L + LL + + ++ EA+ I Sbjct: 1229 EYKTEAMQSLDMILKYLTLRFFDTNTTVLIKCLEFLVALFTLLAESDYQMLEHEASSFIP 1288 Query: 236 FATTKLFQSKDVVLR--RLVYLCIKELSPMAQ 325 + TK+ KDVV + R ++ I ++ P ++ Sbjct: 1289 YLVTKVGDPKDVVRKMIRSLFKLITKVYPASK 1320 >SB_52239| Best HMM Match : Adaptin_N (HMM E-Value=9.9e-36) Length = 723 Score = 29.5 bits (63), Expect = 2.8 Identities = 23/100 (23%), Positives = 50/100 (50%), Gaps = 7/100 (7%) Frame = +2 Query: 167 LTKILYLLNQGEELTTQEATDIFFATTKLFQSKDVVLRRLVYLCIKELSP-------MAQ 325 L K++ ++ GE+ T T I F L +D +++L+ L E+ P + Sbjct: 233 LKKVIQMILNGEKFPTLLMTVIKF----LMPLQDHTIKKLL-LIFWEIVPKTGADGKLLH 287 Query: 326 DVIIVTSSLTKDMTGKDDEYRPAAIRALCSITDSTMLQAI 445 ++I+V + KD+ ++ R + +R LC + ++ +L+ + Sbjct: 288 EMILVCDAYRKDLQHPNEFIRGSTLRFLCKLKEAELLEPL 327 >SB_7863| Best HMM Match : Pentaxin (HMM E-Value=1.8) Length = 604 Score = 29.5 bits (63), Expect = 2.8 Identities = 13/43 (30%), Positives = 18/43 (41%) Frame = -3 Query: 427 TVCDATQSSNGGRSVLIVFTRHVLRK*RSHNDHILCHRTQLFN 299 TVCD N R +++ + + HN H HR FN Sbjct: 48 TVCDRHGQLNVSRVLIVFMVKKIATGFHQHNGHTSFHRCHAFN 90 >SB_7325| Best HMM Match : SNF2_N (HMM E-Value=8.9e-32) Length = 884 Score = 29.1 bits (62), Expect = 3.8 Identities = 21/68 (30%), Positives = 31/68 (45%), Gaps = 2/68 (2%) Frame = -1 Query: 198 PWFSK*SIFVKIWM-HFLGCTGVELKYLA-SCKRVVLSRFWKTLLSSSFPSRRAFIMLCS 25 PW S + V +W F T V +K +A C + SRF SS R AF++ C Sbjct: 23 PWRSS-KVLVVVWKPKFAAPTIVFVKEMAFRCSKFFASRFSHIRKSSKDIKRSAFLLPCL 81 Query: 24 FNILL*FR 1 + + +R Sbjct: 82 LQVFVNYR 89 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 28.3 bits (60), Expect = 6.6 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = -2 Query: 629 QQQQPRHGKKPSHDLKSWPPVLHLSSDALNPVRWLTDAKR 510 Q +PRH +P+HD + H +D + R D R Sbjct: 60 QPDRPRHAARPTHDTQPDQHTTHSQTDTRHAARPTNDTAR 99 >SB_27592| Best HMM Match : 7tm_1 (HMM E-Value=3.8e-39) Length = 340 Score = 27.9 bits (59), Expect = 8.7 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -2 Query: 617 PRHGKKPSHDLKSWPPVLHLSSDALNPV 534 P+ GK ++L + +LH S+ A+NP+ Sbjct: 261 PKRGKGVPYELVQFTKLLHYSNSAINPI 288 >SB_11945| Best HMM Match : EURL (HMM E-Value=9.7) Length = 323 Score = 27.9 bits (59), Expect = 8.7 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Frame = +2 Query: 11 NKILKEQSIMKARRDGKEEDSNVFQNLDKTTLLQEARYF--NSTPVHPRKCIH-ILTKIL 181 NK+LK+ + KA+ K +F L ++ QEAR + P P++ L+ ++ Sbjct: 230 NKLLKKNTFNKAKDRIKSRKEEIFGILSDSSKDQEARQVIEDILPASPKEGKRSFLSSVV 289 Query: 182 YLLNQGEE 205 NQ EE Sbjct: 290 KSFNQSEE 297 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,094,020 Number of Sequences: 59808 Number of extensions: 493162 Number of successful extensions: 1230 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1229 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -