BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0487 (531 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 24 1.1 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.6 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 4.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.5 DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated... 21 5.9 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 23.8 bits (49), Expect = 1.1 Identities = 7/20 (35%), Positives = 15/20 (75%) Frame = +3 Query: 366 VDSVLDVVRKESESCDCLQG 425 +DS+++++R ++CD L G Sbjct: 106 IDSIINIIRVRVDACDRLWG 125 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 22.6 bits (46), Expect = 2.6 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +1 Query: 160 WSASMYTTMKPPAASTCPAPFSSTWSPAPWTL 255 W S+ T M+ A+ C A + PW L Sbjct: 35 WRDSLPTKMRELNATACAALYERVEWSGPWIL 66 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -1 Query: 168 CAPTASQSPHGRHRWGRCRARQ 103 C+P Q+P R GR R R+ Sbjct: 392 CSPPPRQTPPSRKESGRRRRRR 413 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 4.5 Identities = 15/60 (25%), Positives = 22/60 (36%) Frame = -2 Query: 305 EDEVVRTEDLSERSGADRVHGAGLQVDENGAGHVLAAGGFIVVYIDALQLQVRVPMVGTG 126 E+ +R +++ G D G DE+ AG A+ V A GTG Sbjct: 178 EERRLRPDEIKVEVGEDEFANGGAARDESKAGSTDASTPATVTTTGATTTLPAASATGTG 237 >DQ667194-1|ABG75746.1| 391|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 391 Score = 21.4 bits (43), Expect = 5.9 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +1 Query: 211 PAPFSSTWSPAPWTLSA 261 P F S W P P+ L+A Sbjct: 65 PEFFDSLWQPDPYFLNA 81 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,983 Number of Sequences: 438 Number of extensions: 3460 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14968302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -