BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0486 (759 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 4.4 DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. 23 7.7 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 4.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 452 DHVQRFDRSPLLFDCADQLSWWREDLEPL 366 D ++ +DR P +F CA + W E+ E L Sbjct: 204 DKIKPYDRIPQIFICA---TMWHENKEEL 229 >DQ974167-1|ABJ52807.1| 434|Anopheles gambiae serpin 8 protein. Length = 434 Score = 23.4 bits (48), Expect = 7.7 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = -1 Query: 609 NLSVTGARNNACVTPCQRLQVPPTGEPSGLKMSNLMSLKQPVSKTPHRVPYSGSRT 442 N S+T R N V+ + Q+P E S L+ + L+ L + +P++ S T Sbjct: 176 NRSLTYERVNRLVSDATQGQIPKAIEMSDLEDARLIMLSVLFFQGQWTIPFNRSFT 231 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 804,959 Number of Sequences: 2352 Number of extensions: 16754 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -