BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0478 (550 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 26 0.94 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 25 1.6 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 25 1.6 AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-sign... 25 1.6 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 24 3.8 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 5.0 AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 23 6.6 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 6.6 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 8.8 M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. 23 8.8 AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CY... 23 8.8 AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 pro... 23 8.8 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 8.8 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 25.8 bits (54), Expect = 0.94 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = +2 Query: 221 PADSPVHHHRVATQSFLEMERGPAAEHRPP 310 P P+HH A+Q F+ +H PP Sbjct: 357 PIYQPLHHFSAASQRFMLRSCNSLGDHIPP 386 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 25.0 bits (52), Expect = 1.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 402 RWRGDSPAVSASDSLSVNLSAMWSISFSATEGG 304 +W D + + +LSV L +W F+A E G Sbjct: 77 KWGKDIEFLLSCIALSVGLGNVWRFPFTALENG 109 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 25.0 bits (52), Expect = 1.6 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = -2 Query: 402 RWRGDSPAVSASDSLSVNLSAMWSISFSATEGG 304 +W D + + +LSV L +W F+A E G Sbjct: 77 KWGKDIEFLLSCIALSVGLGNVWRFPFTALENG 109 >AJ439060-10|CAD27761.1| 1197|Anopheles gambiae putative FGF-signaling promoter protein. Length = 1197 Score = 25.0 bits (52), Expect = 1.6 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = -2 Query: 381 AVSASDSLSVNLSAMWSISFSATEGGRCSAAG 286 AV SLS+++++M S + + GGR S+ G Sbjct: 988 AVVRPQSLSLSMNSMGSDNSEQSSGGRLSSGG 1019 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.8 bits (49), Expect = 3.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 283 TFHLQETLSGHAMM 242 TFHL + LSGH + Sbjct: 928 TFHLSQVLSGHGFL 941 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = -3 Query: 185 HPSSPGRASW 156 H SSPGR SW Sbjct: 1216 HKSSPGRGSW 1225 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 23.0 bits (47), Expect = 6.6 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 Query: 333 TTWPTNLPTVSQ 368 T WPT+ PT SQ Sbjct: 384 TDWPTHQPTTSQ 395 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 6.6 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 283 TFHLQETLSGH 251 TFHL + LSGH Sbjct: 988 TFHLSQVLSGH 998 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 283 TFHLQETLSGH 251 TFHL + LSGH Sbjct: 976 TFHLAQVLSGH 986 >M93690-2|AAA29363.1| 1212|Anopheles gambiae unknown protein. Length = 1212 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = -1 Query: 283 TFHLQETLSGH 251 TFHL + LSGH Sbjct: 980 TFHLAQVLSGH 990 >AY176048-1|AAO19579.1| 521|Anopheles gambiae cytochrome P450 CYP12F4 protein. Length = 521 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +2 Query: 260 QSFLEMERGPAAEHRPPSVAEKLM 331 ++ + ME+ P+A+ S+ EKL+ Sbjct: 283 EAVIRMEKNPSADQDTLSILEKLL 306 >AF281078-2|AAF82132.1| 755|Anopheles gambiae vitellogenin 2 protein. Length = 755 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 344 DKFTDSESDADTAGESPLHRPEP 412 D ++ SESD+D+ ++P P Sbjct: 475 DFYSSSESDSDSLSSEEFYQPIP 497 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 22.6 bits (46), Expect = 8.8 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 344 DKFTDSESDADTAGESPLHRPEP 412 D ++ SESD+D+ ++P P Sbjct: 475 DFYSSSESDSDSLSSEEFYQPIP 497 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 529,472 Number of Sequences: 2352 Number of extensions: 10053 Number of successful extensions: 28 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -