BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0476 (492 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 23 4.3 AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. 23 7.5 AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled ... 23 7.5 X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. 22 9.9 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 22 9.9 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 22 9.9 AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transpo... 22 9.9 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 22 9.9 AY341179-1|AAR13743.1| 191|Anopheles gambiae Gambif protein. 22 9.9 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 22 9.9 AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transpo... 22 9.9 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 22 9.9 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 23.4 bits (48), Expect = 4.3 Identities = 9/22 (40%), Positives = 12/22 (54%), Gaps = 2/22 (9%) Frame = +1 Query: 361 WHTC--CCSRLCTAGRTKKWLP 420 W C CCSR C+ + K+ P Sbjct: 35 WMLCEVCCSRKCSRNGSPKFAP 56 >AY578807-1|AAT07312.1| 438|Anopheles gambiae punt protein. Length = 438 Score = 22.6 bits (46), Expect = 7.5 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = +1 Query: 373 CCSRLCTAGRTKKWLPTWTQ 432 CC R R KW+P T+ Sbjct: 34 CCCRGSMCNREHKWIPEATK 53 >AY553322-1|AAT36323.1| 426|Anopheles gambiae G-protein coupled receptor 4 protein. Length = 426 Score = 22.6 bits (46), Expect = 7.5 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 139 YNLFNLFGVFFLPL 98 YNLF + ++FLPL Sbjct: 243 YNLFCVIAMYFLPL 256 >X95912-1|CAA65156.1| 696|Anopheles gambiae immune factor protein. Length = 696 Score = 22.2 bits (45), Expect = 9.9 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +2 Query: 305 VKSPAEDHFKNEIELGQSRGIHVVVAGCVPQGAPKSGYLHGLSIVGVQQIDRIVEVVE 478 V + AE I++ RG VVV CV + P+ H ++VG + + V VE Sbjct: 78 VNTTAEQKTFPSIQVHGYRGRAVVVVSCVTKEGPEH-KPHPHNLVGKEGCKKGVCTVE 134 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 28 GAPVGTKTASETAGPR 43 >AY536865-1|AAT07965.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 22.2 bits (45), Expect = 9.9 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +2 Query: 233 LAANGYKLTEDKWDAQLWLLNSCTVKS 313 L N +K+ DKW + L SC S Sbjct: 66 LMKNIHKVQRDKWGKDIEFLLSCIALS 92 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 22.2 bits (45), Expect = 9.9 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -1 Query: 405 GAPCGTQPATTTCMPR 358 GAP GT+ A+ T PR Sbjct: 12 GAPVGTKTASETAGPR 27 >AY341179-1|AAR13743.1| 191|Anopheles gambiae Gambif protein. Length = 191 Score = 22.2 bits (45), Expect = 9.9 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +2 Query: 305 VKSPAEDHFKNEIELGQSRGIHVVVAGCVPQGAPKSGYLHGLSIVGVQQIDRIVEVVE 478 V + AE I++ RG VVV CV + P+ H ++VG + + V VE Sbjct: 14 VNTTAEQKTFPSIQVHGYRGRAVVVVSCVTKEGPEH-KPHPHNLVGKEGCKKGVCTVE 70 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 22.2 bits (45), Expect = 9.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 209 LSCYEHSP 186 LSCYEH+P Sbjct: 163 LSCYEHAP 170 >AJ626713-1|CAF25029.1| 650|Anopheles gambiae tryptophan transporter protein. Length = 650 Score = 22.2 bits (45), Expect = 9.9 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +2 Query: 233 LAANGYKLTEDKWDAQLWLLNSCTVKS 313 L N +K+ DKW + L SC S Sbjct: 66 LMKNIHKVQRDKWGKDIEFLLSCIALS 92 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 22.2 bits (45), Expect = 9.9 Identities = 7/8 (87%), Positives = 8/8 (100%) Frame = -2 Query: 209 LSCYEHSP 186 LSCYEH+P Sbjct: 164 LSCYEHAP 171 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 536,452 Number of Sequences: 2352 Number of extensions: 11130 Number of successful extensions: 36 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 43554477 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -