BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0473 (680 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor typ... 23 2.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 6.2 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 8.2 >AF498306-5|AAM19330.1| 456|Apis mellifera dopamine receptor type D2 protein. Length = 456 Score = 23.4 bits (48), Expect = 2.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 300 CSCGKGRLRRRGSQALCRIKPA 235 C+C GR+RRR A R KP+ Sbjct: 406 CACCPGRVRRRYQPAF-RCKPS 426 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 6.2 Identities = 15/45 (33%), Positives = 21/45 (46%), Gaps = 2/45 (4%) Frame = -2 Query: 388 TPAGMTTTSASLMAADSSSGPLWPLTLAGVFMWERSAA--TPGVT 260 TPA +TTT A+ +S+ P T + V + A T G T Sbjct: 215 TPATVTTTGATTTLPAASATGTGPATPSAVVATSNATAAMTTGTT 259 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/29 (27%), Positives = 12/29 (41%) Frame = +2 Query: 212 EAESSGDQAGFIRHSACDPRRRSRPFPHE 298 E G G+ CD R++ P P + Sbjct: 154 ELSQPGSLNGYGSSDGCDARKKKGPTPRQ 182 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 202,905 Number of Sequences: 438 Number of extensions: 4837 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -