BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0471 (654 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 2.9 AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII pr... 23 2.9 AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII pr... 23 2.9 AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombi... 22 5.1 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 8.9 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 8.9 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.6 bits (46), Expect = 2.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = +3 Query: 48 RQHHPPRRHNGSPSGNRHQQ 107 RQ PP + G PSG + Q Sbjct: 57 RQGIPPHHYGGPPSGGQPPQ 76 >AF017415-1|AAB70262.1| 343|Tribolium castaneum abdominal-AII protein. Length = 343 Score = 22.6 bits (46), Expect = 2.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 60 PPRRHNGSPSGNRHQQFPSQASTLP 134 P + SPSG+ Q S AST P Sbjct: 32 PAAYSSSSPSGSSPQHSSSSASTSP 56 >AF017414-1|AAB70260.1| 209|Tribolium castaneum abdominal-AII protein. Length = 209 Score = 22.6 bits (46), Expect = 2.9 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = +3 Query: 60 PPRRHNGSPSGNRHQQFPSQASTLP 134 P + SPSG+ Q S AST P Sbjct: 32 PAAYSSSSPSGSSPQHSSSSASTSP 56 >AY531876-2|AAT08871.1| 340|Tribolium castaneum tyrosine recombinase protein. Length = 340 Score = 21.8 bits (44), Expect = 5.1 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 244 HLLFEHWNHLARVPSTVMYMKPEKFQKLQQLNPNF 348 ++LF R+P + P KFQ L +L P F Sbjct: 187 NILFSAEGVEIRIPDVIKTSGPHKFQPLLRL-PKF 220 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +1 Query: 310 EKFQKLQQLNPNFASLI 360 E+ QKL++ NP+ +L+ Sbjct: 149 ERIQKLKKANPSLKTLL 165 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.0 bits (42), Expect = 8.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 208 PHPHAAHKAI 237 PHP AAH A+ Sbjct: 120 PHPAAAHSAL 129 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,668 Number of Sequences: 336 Number of extensions: 4077 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -