BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0471 (654 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g65330.1 68418.m08218 MADS-box family protein contains Pfam p... 30 1.5 At5g42130.1 68418.m05129 mitochondrial substrate carrier family ... 30 1.5 At3g10070.1 68416.m01207 transcription initiation factor IID (TF... 30 1.5 At3g12420.1 68416.m01547 hypothetical protein 29 2.0 At1g60690.1 68414.m06832 aldo/keto reductase family protein cont... 28 4.7 At3g24600.1 68416.m03090 hypothetical protein 28 6.2 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 28 6.2 At1g60710.1 68414.m06834 aldo/keto reductase family protein cont... 28 6.2 At1g10810.1 68414.m01241 aldo/keto reductase family protein cont... 28 6.2 At5g41170.1 68418.m05004 pentatricopeptide (PPR) repeat-containi... 27 8.2 At3g12240.1 68416.m01527 serine carboxypeptidase S10 family prot... 27 8.2 >At5g65330.1 68418.m08218 MADS-box family protein contains Pfam profile PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); MADS-box protein AGL78 Length = 341 Score = 29.9 bits (64), Expect = 1.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +1 Query: 301 MKPEKFQKLQQLNPNFASLINFRHTPKDITRYPVSNPH 414 + P + Q LNP+ SL + H +++ P+S PH Sbjct: 147 LTPSYLNQTQHLNPSKFSLFMYNHGDATLSQLPLSAPH 184 >At5g42130.1 68418.m05129 mitochondrial substrate carrier family protein contains Pfam profile: PF00153 mitochondrial carrier protein Length = 412 Score = 29.9 bits (64), Expect = 1.5 Identities = 20/69 (28%), Positives = 33/69 (47%) Frame = +1 Query: 205 SPHPHAAHKAIETHLLFEHWNHLARVPSTVMYMKPEKFQKLQQLNPNFASLINFRHTPKD 384 SP+ + H E + LF H++ L V S ++ P+ K Q P F++ NFR + Sbjct: 13 SPNLNHCHFPNEFNSLFTHFSDLTSVQSPIV-RNPKLKTKSSQKPPKFSA--NFRRSDPP 69 Query: 385 ITRYPVSNP 411 +S+P Sbjct: 70 FASTSISDP 78 >At3g10070.1 68416.m01207 transcription initiation factor IID (TFIID) subunit A family protein similar to hypothetical protein GB:CAB10099 [Schizosaccharomyces pombe]; contains Pfam profile PF03847: Transcription initiation factor TFIID subunit A Length = 539 Score = 29.9 bits (64), Expect = 1.5 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +3 Query: 84 PSG-NRHQQFPSQASTLPISGKFQANPIAQSTRHRS 188 PSG +HQQ P+Q+S P S +P+AQ+ + S Sbjct: 216 PSGMTQHQQRPTQSSLRPASSTSTQSPVAQNFQGHS 251 >At3g12420.1 68416.m01547 hypothetical protein Length = 308 Score = 29.5 bits (63), Expect = 2.0 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Frame = +3 Query: 39 RYSRQHHPPRRHNGSPSGNRH---QQFPSQASTLPISGKFQANPIAQSTRHRSH 191 RY HHPPR ++ +P NR+ P P ++ AN + + R+ H Sbjct: 79 RYYSDHHPPRSYDPNPPPNRYYSDHHPPRSYDRNPPPNRYDANDLPPN-RYYDH 131 Score = 29.5 bits (63), Expect = 2.0 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +3 Query: 36 SRYSRQHHPPRRHNGSPSGNRH 101 +RY HHPPR ++ +P NR+ Sbjct: 97 NRYYSDHHPPRSYDRNPPPNRY 118 >At1g60690.1 68414.m06832 aldo/keto reductase family protein contains Pfam profile PF00248: oxidoreductase, aldo/keto reductase family Length = 345 Score = 28.3 bits (60), Expect = 4.7 Identities = 17/58 (29%), Positives = 30/58 (51%) Frame = +1 Query: 25 FTNLVDTLANTIHRDAITAPLVETAISNFRHKLQLYPYQVNSKLIPLLNQLGIGVTSY 198 + L + A+TI R P+ TA+ + + L+ V +++P +LGIG+ SY Sbjct: 156 YIGLSEASASTIRRAHTVHPI--TAV---QLEWSLWTRDVEEEIVPTCRELGIGIVSY 208 >At3g24600.1 68416.m03090 hypothetical protein Length = 506 Score = 27.9 bits (59), Expect = 6.2 Identities = 18/58 (31%), Positives = 27/58 (46%) Frame = +1 Query: 58 IHRDAITAPLVETAISNFRHKLQLYPYQVNSKLIPLLNQLGIGVTSYGTSPHPHAAHK 231 IH + T L +A++ +L+ Y SK I ++ G V YG PH A+ K Sbjct: 391 IHVSSSTFKLTFSALTLATGQLKSYYQPRKSKHISIVKLTGAEVPLYGAGPHLAASDK 448 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 27.9 bits (59), Expect = 6.2 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 37 VDTLANTIHRDAITAPLVETAISNFRHKLQLYPYQVNSKLIPLL 168 + ++ N I +DA A L + + N L+L PY +K + LL Sbjct: 304 IQSVVNPIKKDAKRAVLKKNPLKNLNVMLKLNPYAKTAKRMSLL 347 >At1g60710.1 68414.m06834 aldo/keto reductase family protein contains Pfam profile PF00248: oxidoreductase, aldo/keto reductase family Length = 345 Score = 27.9 bits (59), Expect = 6.2 Identities = 16/58 (27%), Positives = 27/58 (46%) Frame = +1 Query: 25 FTNLVDTLANTIHRDAITAPLVETAISNFRHKLQLYPYQVNSKLIPLLNQLGIGVTSY 198 + L + A+TI R P+ I + L+ V ++IP +LGIG+ +Y Sbjct: 156 YIGLSEASASTIRRAHAVHPITAVQI-----EWSLWTRDVEEEIIPTCRELGIGIVAY 208 >At1g10810.1 68414.m01241 aldo/keto reductase family protein contains Pfam profile PF00248: oxidoreductase, aldo/keto reductase family Length = 344 Score = 27.9 bits (59), Expect = 6.2 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +1 Query: 25 FTNLVDTLANTIHRDAITAPLVETAISNFRHKLQLYPYQVNSKLIPLLNQLGIGVTSY 198 + L + A+TI R PL TA+ + + L+ V +IP +LGIG+ +Y Sbjct: 156 YIGLSEACASTIRRAHAVHPL--TAV---QLEWSLWSRDVEEDIIPTCRELGIGIVAY 208 >At5g41170.1 68418.m05004 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 527 Score = 27.5 bits (58), Expect = 8.2 Identities = 16/60 (26%), Positives = 29/60 (48%) Frame = +1 Query: 439 MHDALMFITPSQILGLFKDSPSMTSLYCSLIVPAEAAYGVPSLFPDLYSYTIKDDQLVYT 618 M +A+ + +G+ D T++ SL Y + SLF + +Y I+ D ++YT Sbjct: 158 MEEAMSMVNQMVEMGIKPDVVMYTTIIDSLCKNGHVNYAL-SLFDQMENYGIRPDVVMYT 216 >At3g12240.1 68416.m01527 serine carboxypeptidase S10 family protein contains Pfam profile: PF00450 serine carboxypeptidase; similar to serine carboxypeptidase I precursor (SP:P37890) [Oryza sativa] Length = 436 Score = 27.5 bits (58), Expect = 8.2 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 1/64 (1%) Frame = -1 Query: 429 FSFYRMRVANGVPSDVLWGVPEVNEGSKVWV*LLKFLEFLRFHIHYRRRN-SGKMIPMFK 253 FS+ R A+ +PSD V VNE + W L K E+ + + SGK+IP Sbjct: 134 FSYSRNPFAD-IPSDT-GSVKRVNEFVRKW--LAKHPEYFSNPFYVTGNSYSGKVIPAIV 189 Query: 252 QEVS 241 QE+S Sbjct: 190 QEIS 193 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,665,708 Number of Sequences: 28952 Number of extensions: 371475 Number of successful extensions: 948 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 908 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 947 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1363910256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -