BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0469 (554 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0738 - 26807046-26807129,26807720-26807957,26809374-268115... 28 5.8 >11_06_0738 - 26807046-26807129,26807720-26807957,26809374-26811509, 26812145-26813253 Length = 1188 Score = 27.9 bits (59), Expect = 5.8 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -2 Query: 385 VPFGITLDSTSCKSNLSKSACSNASKSM*MRGLVA-SASSSKYTNCFSLLG 236 +P GIT ST+ + ++S ++ ++ M GLV +A+ +K N + G Sbjct: 237 IPTGITTTSTTTRGDVSSTSSRQPTRFMESAGLVGINAAVNKLENLLDVCG 287 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,551,849 Number of Sequences: 37544 Number of extensions: 190984 Number of successful extensions: 386 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 386 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1257681096 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -