BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0457 (341 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0470 + 23977394-23977503,23977755-23977922,23978724-239793... 31 0.18 01_05_0553 + 23185473-23186188,23187096-23187101,23187230-231873... 29 0.72 08_02_0925 - 22668875-22668889,22668942-22669018,22669383-226695... 29 0.95 07_03_0909 + 22512313-22512474,22513151-22513465,22513539-225166... 29 1.3 02_04_0552 - 23804154-23805326 28 1.7 03_06_0744 + 35910512-35910569,35911145-35911325,35912332-359124... 28 2.2 03_05_0092 - 20714102-20717902 28 2.2 02_01_0424 - 3097245-3099377 28 2.2 02_04_0418 - 22742220-22743108,22743393-22743397 26 6.7 01_06_1501 + 37804029-37804600,37804626-37805388 26 6.7 12_02_0001 - 12066231-12066341,12066745-12066825,12067056-120671... 26 8.9 11_06_0103 + 20131153-20131418,20132256-20132331,20132602-20132625 26 8.9 07_03_1516 + 27367518-27368552,27368828-27369097,27369616-27370062 26 8.9 03_01_0321 + 2512830-2513114,2513390-2513428,2513647-2513674,251... 26 8.9 >11_06_0470 + 23977394-23977503,23977755-23977922,23978724-23979367, 23979584-23979823,23980175-23980296,23980397-23981080 Length = 655 Score = 31.5 bits (68), Expect = 0.18 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 5/54 (9%) Frame = -3 Query: 210 SHRSLDEHVES-----EKSNTPSNFVNCVWRSFKTQTLNVPFEKLYTKWSCERI 64 SH+S+D V+ K+N VNC+ RS + +VPF K + C I Sbjct: 131 SHKSIDAAVKDTIRHLRKNNVELTKVNCILRSMRGSAESVPFTKNSVRTVCAEI 184 >01_05_0553 + 23185473-23186188,23187096-23187101,23187230-23187374, 23187887-23188159,23188275-23188338,23188479-23188744, 23188951-23189045,23189544-23189718,23190669-23191063, 23191830-23191953,23192864-23192959,23193049-23193120, 23194687-23194824,23195369-23195549,23195602-23195963, 23196944-23197386,23197461-23197763,23197857-23198081, 23198260-23198350,23198702-23198779,23198939-23199229, 23199316-23199513,23199681-23200163,23200488-23200562, 23201163-23201324,23201400-23201729,23201816-23201916, 23202477-23202581,23202931-23203162,23203913-23204257, 23204346-23204447,23206010-23206153,23206463-23206551, 23206979-23207061,23207172-23207287,23207824-23207909, 23208461-23208560,23209270-23209335 Length = 2451 Score = 29.5 bits (63), Expect = 0.72 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = -3 Query: 276 SLFYIDDHSLMTEARFLRAPEISHRSLDEHVESEKSNTPSNFV 148 SL ++DD ++E +SH D +VESE+ N ++FV Sbjct: 589 SLLHMDDSIKLSEVAPSEC-SVSHECFDSNVESEEKNMVTSFV 630 >08_02_0925 - 22668875-22668889,22668942-22669018,22669383-22669500, 22669662-22669685,22670067-22670360,22670456-22670563, 22671098-22671946 Length = 494 Score = 29.1 bits (62), Expect = 0.95 Identities = 21/77 (27%), Positives = 34/77 (44%), Gaps = 2/77 (2%) Frame = -3 Query: 294 RTCFLCSLFYIDDHSLMTEARFLRAPEISHRSLD--EHVESEKSNTPSNFVNCVWRSFKT 121 R+ L + FY L T RAP + H ++ +H E++ +F+N +W + Sbjct: 286 RSLTLHTNFYKASSILSTFGLLTRAPNLLHLEIEITDH-ENQSDEVDIDFLNALWTNSLF 344 Query: 120 QTLNVPFEKLYTKWSCE 70 L+ K T WS E Sbjct: 345 ANLDFVSIKSATCWSNE 361 >07_03_0909 + 22512313-22512474,22513151-22513465,22513539-22516633, 22516812-22516910,22517031-22517379 Length = 1339 Score = 28.7 bits (61), Expect = 1.3 Identities = 21/52 (40%), Positives = 27/52 (51%) Frame = +2 Query: 41 LNECSVLSILSQLHFVYNFSNGTLSVCVLNDRHTQFTKFEGVFDFSLSTCSS 196 +NE S LS S+ H SNG+L V VL T + +FEG S+ C S Sbjct: 389 VNEVSFLSYNSKNHIAAYLSNGSLCVSVLPVADT-WEEFEG-SGISVDPCFS 438 >02_04_0552 - 23804154-23805326 Length = 390 Score = 28.3 bits (60), Expect = 1.7 Identities = 15/43 (34%), Positives = 24/43 (55%) Frame = +2 Query: 17 LLSVAHRQLNECSVLSILSQLHFVYNFSNGTLSVCVLNDRHTQ 145 ++S+A LN L S+LH + +S+ +S CVL +TQ Sbjct: 348 VISIARWTLNPPGALPWSSELHELTGYSSQDISSCVLTVLNTQ 390 >03_06_0744 + 35910512-35910569,35911145-35911325,35912332-35912419, 35912541-35912726,35913591-35913725,35913803-35913862, 35914609-35914698,35915384-35915515,35916039-35916183, 35916266-35916439,35916629-35916692,35916778-35916847, 35917328-35917445,35918258-35918280,35918398-35918499, 35919831-35920250,35920327-35920563 Length = 760 Score = 27.9 bits (59), Expect = 2.2 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 271 FLHRRSLAHDGGAVSTGARDI 209 F H AHD GAVSTGA + Sbjct: 39 FSHGADSAHDAGAVSTGASGV 59 >03_05_0092 - 20714102-20717902 Length = 1266 Score = 27.9 bits (59), Expect = 2.2 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -3 Query: 288 CFLCSLFYIDDHSLMTEARFLRAPEISHRSLDEHVESEKSNTPSNFVNCVW 136 CF+ ++DD+ + L+ H S D+ ES S P +++NC++ Sbjct: 1078 CFITHGAWVDDYPFLFSVWTLKVTSCPHVSTDQ--ESSFSIEPLDWLNCLF 1126 >02_01_0424 - 3097245-3099377 Length = 710 Score = 27.9 bits (59), Expect = 2.2 Identities = 19/53 (35%), Positives = 22/53 (41%), Gaps = 5/53 (9%) Frame = +2 Query: 53 SVLSILSQLHFVYNFSNGTLSVCV-----LNDRHTQFTKFEGVFDFSLSTCSS 196 S LS L LH YN GT+ V LN F KF G F ++ S Sbjct: 339 SKLSSLKSLHVSYNSFAGTIPESVYTCSNLNALQLSFNKFHGQLSFRITNLKS 391 >02_04_0418 - 22742220-22743108,22743393-22743397 Length = 297 Score = 26.2 bits (55), Expect = 6.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -3 Query: 171 SNTPSNFVNCVWRSFKTQTLNVP 103 +NT + + +WRSF+T +NVP Sbjct: 129 ANTTALSLRPMWRSFETSIVNVP 151 >01_06_1501 + 37804029-37804600,37804626-37805388 Length = 444 Score = 26.2 bits (55), Expect = 6.7 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -2 Query: 262 RRSLAHDGGAVSTGARDIASIPRRACRK*KVKH 164 RR L HDGG +PRRA R + +H Sbjct: 117 RRVLGHDGGVPPRLLARHGDVPRRATRPRRRRH 149 >12_02_0001 - 12066231-12066341,12066745-12066825,12067056-12067136, 12068017-12068097,12068337-12068417,12068492-12068572, 12068647-12068727,12070748-12070828,12070903-12070983, 12071551-12071631,12072036-12072116,12072519-12072599, 12072839-12072919,12073468-12073548,12074108-12074188, 12074428-12074508,12075076-12075156,12075396-12075476, 12075561-12075641,12076356-12076436,12076676-12076756, 12077326-12077406,12077811-12077891,12078131-12078211, 12078286-12078366,12079586-12079666,12079906-12079986, 12081341-12081421,12081793-12081873,12083074-12083154, 12083714-12083794,12084034-12084114,12084354-12084434, 12084674-12084754,12084829-12084909,12084984-12085064, 12085304-12085384,12087109-12087189,12087429-12087509, 12087584-12087664,12089204-12089284,12090339-12090419, 12090659-12090739,12091621-12091701,12092754-12092834, 12093074-12093154,12093155-12093310,12093550-12093630, 12094454-12094512,12094610-12094691,12096312-12096392, 12096789-12096869,12097768-12097907,12099296-12099377, 12100185-12100265,12100999-12101079,12101484-12101564, 12101814-12101894,12102628-12102708,12103744-12103824, 12104869-12104949,12105189-12105269,12105509-12105589, 12106322-12106402,12106477-12106557,12107448-12107528, 12108050-12108145,12109578-12109584,12110097-12110293 Length = 1929 Score = 25.8 bits (54), Expect = 8.9 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = +1 Query: 49 VQCALDSLAAPFC 87 +QC+L SLA+PFC Sbjct: 11 LQCSLPSLASPFC 23 >11_06_0103 + 20131153-20131418,20132256-20132331,20132602-20132625 Length = 121 Score = 25.8 bits (54), Expect = 8.9 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -2 Query: 265 HRRSLAHDGGAVSTGARDIASIPRRACRK 179 H L GGA S G R + PRR CR+ Sbjct: 10 HLLVLVGGGGADSRGQRRRSRSPRRRCRR 38 >07_03_1516 + 27367518-27368552,27368828-27369097,27369616-27370062 Length = 583 Score = 25.8 bits (54), Expect = 8.9 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 307 LTIRPXMFPVFTFLHRRSLAHDGG 236 L I +F VF+F+ RRSL GG Sbjct: 144 LYITACIFEVFSFIPRRSLIRHGG 167 >03_01_0321 + 2512830-2513114,2513390-2513428,2513647-2513674, 2513893-2513975,2514104-2514144,2514539-2514624, 2514941-2514963 Length = 194 Score = 25.8 bits (54), Expect = 8.9 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 2/35 (5%) Frame = +2 Query: 5 CSGRLLSVAHRQLNE--CSVLSILSQLHFVYNFSN 103 C LLS + L + C LS+ S HF+YN ++ Sbjct: 135 CMQLLLSKLSKMLCDINCDPLSLYSSFHFLYNLTS 169 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,223,145 Number of Sequences: 37544 Number of extensions: 166276 Number of successful extensions: 486 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 482105440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -