BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0457 (341 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT001321-1|AAN71076.1| 1023|Drosophila melanogaster AT15860p pro... 27 4.8 AY089344-1|AAL90082.1| 922|Drosophila melanogaster AT16542p pro... 27 4.8 AE014296-2480|AAF49661.2| 922|Drosophila melanogaster CG13457-P... 27 4.8 AE014296-2479|AAN11789.1| 1023|Drosophila melanogaster CG13457-P... 27 4.8 AE014298-948|AAN09184.1| 3313|Drosophila melanogaster CG14438-PB... 27 6.4 AE014298-947|AAF46197.2| 3313|Drosophila melanogaster CG14438-PA... 27 6.4 >BT001321-1|AAN71076.1| 1023|Drosophila melanogaster AT15860p protein. Length = 1023 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 210 SHRSLDEHVESEKSNTPSNFVNCVWRSFKTQT 115 S+ S+D S K T C+WR TQT Sbjct: 577 SYTSIDPQPPSAKHETKDTQTECLWRERPTQT 608 >AY089344-1|AAL90082.1| 922|Drosophila melanogaster AT16542p protein. Length = 922 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 210 SHRSLDEHVESEKSNTPSNFVNCVWRSFKTQT 115 S+ S+D S K T C+WR TQT Sbjct: 476 SYTSIDPQPPSAKHETKDTQTECLWRERPTQT 507 >AE014296-2480|AAF49661.2| 922|Drosophila melanogaster CG13457-PA, isoform A protein. Length = 922 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 210 SHRSLDEHVESEKSNTPSNFVNCVWRSFKTQT 115 S+ S+D S K T C+WR TQT Sbjct: 476 SYTSIDPQPPSAKHETKDTQTECLWRERPTQT 507 >AE014296-2479|AAN11789.1| 1023|Drosophila melanogaster CG13457-PB, isoform B protein. Length = 1023 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -3 Query: 210 SHRSLDEHVESEKSNTPSNFVNCVWRSFKTQT 115 S+ S+D S K T C+WR TQT Sbjct: 577 SYTSIDPQPPSAKHETKDTQTECLWRERPTQT 608 >AE014298-948|AAN09184.1| 3313|Drosophila melanogaster CG14438-PB, isoform B protein. Length = 3313 Score = 27.1 bits (57), Expect = 6.4 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = -3 Query: 261 DDHSLMTEARFLRAPEISHRSLDEH 187 +D + TEAR+L+AP+++ SL E+ Sbjct: 2695 NDSNKTTEARWLKAPKLARHSLMEY 2719 >AE014298-947|AAF46197.2| 3313|Drosophila melanogaster CG14438-PA, isoform A protein. Length = 3313 Score = 27.1 bits (57), Expect = 6.4 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = -3 Query: 261 DDHSLMTEARFLRAPEISHRSLDEH 187 +D + TEAR+L+AP+++ SL E+ Sbjct: 2695 NDSNKTTEARWLKAPKLARHSLMEY 2719 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,478,291 Number of Sequences: 53049 Number of extensions: 289704 Number of successful extensions: 761 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 761 length of database: 24,988,368 effective HSP length: 75 effective length of database: 21,009,693 effective search space used: 798368334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -