BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0456 (425 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 25 0.31 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 2.9 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 25.0 bits (52), Expect = 0.31 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +3 Query: 162 INDSQNTVLFNLSVKIFNRVFFNPCSAELVLQK 260 IN + N +L+N+ F FF C ++V ++ Sbjct: 344 INSAVNPILYNIISSKFRSGFFKLCGMKIVKKR 376 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.8 bits (44), Expect = 2.9 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 370 NLLINVMYARAISHSSP 420 N LIN++YA S+S P Sbjct: 384 NPLINILYANMNSYSVP 400 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,956 Number of Sequences: 336 Number of extensions: 1361 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9490410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -