BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0456 (425 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g27940.1 68415.m03387 zinc finger (C3HC4-type RING finger) fa... 27 7.0 At2g14570.1 68415.m01632 SWIM zinc finger family protein 26 9.3 >At2g27940.1 68415.m03387 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097 zinc finger, C3HC4 type (RING finger) Length = 237 Score = 26.6 bits (56), Expect = 7.0 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%) Frame = -2 Query: 325 IFVLFLSKSFL*GTFFQKYFXHFCKTSSA---LQGLKKTRLNILTLKLKST 182 IF+L ++ F+ FF YF HF +SS+ + + +TR + ++ + ST Sbjct: 54 IFILLVALFFM--GFFSVYFRHFADSSSSTVDISSMPRTRSSRMSPRRLST 102 >At2g14570.1 68415.m01632 SWIM zinc finger family protein Length = 435 Score = 26.2 bits (55), Expect = 9.3 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 352 LFIKVXNLLINVMYARAISHSSPY 423 LF K+ N L +VMY + +S++ PY Sbjct: 47 LFTKLRNKLGDVMYWKKVSYTYPY 70 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,869,631 Number of Sequences: 28952 Number of extensions: 98594 Number of successful extensions: 187 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 187 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 665183504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -