BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0454 (450 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 2.3 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 21 4.0 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 4.0 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 21 7.1 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 20 9.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 22.2 bits (45), Expect = 2.3 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +1 Query: 229 CVSKEAGHQTSAESW 273 C K+ GH+ S SW Sbjct: 1152 CEEKKPGHKPSTSSW 1166 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.4 bits (43), Expect = 4.0 Identities = 10/34 (29%), Positives = 13/34 (38%), Gaps = 3/34 (8%) Frame = -3 Query: 343 HPDRTYEYH---HHGHAEFGRQHVQYPMIQHWFG 251 HP T+ YH H+ F H + FG Sbjct: 158 HPGMTFRYHFNVHNSGTHFWHSHSGFQRSDGTFG 191 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.4 bits (43), Expect = 4.0 Identities = 7/14 (50%), Positives = 11/14 (78%) Frame = -3 Query: 130 HPAPSHSSLNTPTL 89 HPA +HS+L +P + Sbjct: 121 HPAAAHSALLSPAM 134 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 20.6 bits (41), Expect = 7.1 Identities = 10/28 (35%), Positives = 13/28 (46%) Frame = +3 Query: 144 PVRVQGAHPSGPGQ*CSRFYVQELEAAL 227 PVR+ G H G C++ E AL Sbjct: 196 PVRIMGVHRPGFDNDCNKNTSTSKEIAL 223 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 20.2 bits (40), Expect = 9.4 Identities = 7/21 (33%), Positives = 12/21 (57%) Frame = +3 Query: 117 DGAGCSQAPPVRVQGAHPSGP 179 + + S PP+ + GA +GP Sbjct: 300 EDSSISGVPPLSIDGALEAGP 320 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,305 Number of Sequences: 336 Number of extensions: 2150 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10195961 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -