BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0454 (450 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 196 5e-51 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.062 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 33 0.082 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 31 0.33 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 29 1.8 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 1.8 SB_14427| Best HMM Match : Cadherin (HMM E-Value=0) 29 1.8 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 28 3.1 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 28 3.1 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.1 SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) 28 3.1 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 28 3.1 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 28 4.1 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 28 4.1 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.1 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 28 4.1 SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.4 SB_34438| Best HMM Match : Ribosomal_L23eN (HMM E-Value=2) 27 5.4 SB_45852| Best HMM Match : I-set (HMM E-Value=0) 27 9.5 SB_50530| Best HMM Match : Pencillinase_R (HMM E-Value=3.3) 27 9.5 SB_46293| Best HMM Match : Keratin_B2 (HMM E-Value=0.00077) 27 9.5 SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) 27 9.5 SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) 27 9.5 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 196 bits (479), Expect = 5e-51 Identities = 89/124 (71%), Positives = 104/124 (83%) Frame = +1 Query: 79 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQT 258 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V+K AGHQT Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQT 59 Query: 259 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHRXVNLRQRRA 438 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK WR+WH VN++QRR Sbjct: 60 SAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWHTKVNVQQRRF 119 Query: 439 ALAA 450 A+ + Sbjct: 120 AVCS 123 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 33.9 bits (74), Expect = 0.062 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 352 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDQPP 239 Y +HP T+ YH H R H Q+P + H + Q P Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTHRYQYQHP 268 Score = 32.7 bits (71), Expect = 0.14 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -3 Query: 352 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDQ 245 Y +HP T+ YHH H + ++ Q+P + H + Q Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTHRYHQQ 447 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/34 (35%), Positives = 16/34 (47%) Frame = -3 Query: 343 HPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDQP 242 HP T+ YH H R H Q+P + H + P Sbjct: 406 HPQVTHRYHQHPQLTH-RYHHQHPQVIHRYHQHP 438 Score = 27.5 bits (58), Expect = 5.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -3 Query: 352 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 260 Y +HP T+ YH R Q+P + H Sbjct: 242 YHQHPQVTHRYHQQHPQVTHRYQYQHPQVTH 272 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 33.5 bits (73), Expect = 0.082 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 367 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWF 254 HH CY H Y Y+ H H + R H YP +H++ Sbjct: 20 HHYCCYCHH---RYCYYRHHHYCWYRHHYHYPCYRHYY 54 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -3 Query: 373 YVHHDTCYRRHPDRTYEYHHHGH 305 Y HH CY RH + Y HH H Sbjct: 25 YCHHRYCYYRHHHYCW-YRHHYH 46 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 31.5 bits (68), Expect = 0.33 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 367 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 284 HH RH R + +HHH H E+ R+H Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH 351 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 1.3 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 376 TYVHHDTCYRRHPDRTYEYHHHGHA 302 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 29.1 bits (62), Expect = 1.8 Identities = 9/35 (25%), Positives = 14/35 (40%) Frame = -3 Query: 379 RTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQY 275 R + HH + H + +HHH H H + Sbjct: 209 RHHQHHQHHHHHHHQHNHHHHHHNHHHHHHHHYHH 243 Score = 26.6 bits (56), Expect = 9.5 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = -3 Query: 367 HHDTCYRRHPDRTYEYHHHGH 305 HH + H + YHHH H Sbjct: 229 HHHNHHHHHHHHYHHYHHHHH 249 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 1.8 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +1 Query: 256 TSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 372 T +E +G ++ R PR RGGG G G G RGGR Sbjct: 983 TPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_14427| Best HMM Match : Cadherin (HMM E-Value=0) Length = 2325 Score = 29.1 bits (62), Expect = 1.8 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 175 DLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAVARI 300 D+ NDV ++++ + PY + H T E TG+ +A++ Sbjct: 2034 DVTNDVTINVTDVNEAPYDIRLVPSHVTVKEDIRTGQCIAQV 2075 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 28.3 bits (60), Expect = 3.1 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = +1 Query: 274 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 402 G GR + R P GGG R G +G M GG P W R Sbjct: 271 GQGRGMGRGP---GGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 310 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 28.3 bits (60), Expect = 3.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 367 HHDTCYRRHPDRTYEYHHH 311 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 3.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -2 Query: 146 GRGLAAPCTVSLFSEYTDTKGRATDRLI 63 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_13625| Best HMM Match : Reprolysin (HMM E-Value=2.3e-15) Length = 715 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/42 (35%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = +1 Query: 169 RPDLVNDVHVSMSKNSRQPYC-VSKEAGHQTSAESWGTGRAV 291 RP +SM K R+PY + +E GH+ S T R V Sbjct: 156 RPGCDTHEKISMEKRKREPYLELIRETGHERQRRSVSTERNV 197 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 28.3 bits (60), Expect = 3.1 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 373 YVHHDTCYRRHPDRTYEYHHHGH 305 Y HH +RR R + +HHH H Sbjct: 233 YHHHHHHHRRRRRRRHHHHHHHH 255 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 27.9 bits (59), Expect = 4.1 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 367 HHDTCYRRHPDRTYEYHHH 311 HH + RH R + YHHH Sbjct: 570 HHHLHHHRHHHRHHHYHHH 588 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 27.9 bits (59), Expect = 4.1 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 367 HHDTCYRRHPDRTYEYHHHGH 305 HH + RH DR + + HH H Sbjct: 340 HHRNKHYRHHDRNHHHRHHHH 360 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 27.9 bits (59), Expect = 4.1 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 355 CYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 260 CY + + + YHHH H H Q+ H Sbjct: 246 CYHKLKNPRHRYHHHHHHHHQHNHHQHHHHHH 277 Score = 27.5 bits (58), Expect = 5.4 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 373 YVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQ 278 Y HH + +H + +HHH H H Q Sbjct: 257 YHHHHHHHHQHNHHQHHHHHHHHHHNHHHHHQ 288 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 27.9 bits (59), Expect = 4.1 Identities = 16/44 (36%), Positives = 19/44 (43%) Frame = +1 Query: 271 WGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 402 WG G+ + R GGG R G +G M GG P W R Sbjct: 24 WGRGQG-GGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 66 >SB_59069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 664 Score = 27.5 bits (58), Expect = 5.4 Identities = 11/25 (44%), Positives = 12/25 (48%) Frame = -3 Query: 376 TYVHHDTCYRRHPDRTYEYHHHGHA 302 TY H DT +HPD H HA Sbjct: 323 TYTHQDTQMHKHPDTQMYVHAPRHA 347 >SB_34438| Best HMM Match : Ribosomal_L23eN (HMM E-Value=2) Length = 772 Score = 27.5 bits (58), Expect = 5.4 Identities = 20/58 (34%), Positives = 23/58 (39%), Gaps = 1/58 (1%) Frame = +1 Query: 214 SRQPYCVSKEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAF-GNMCRGGRMFAP 384 SRQPY + GH G G P +RGG + G G G G R AP Sbjct: 110 SRQPYGPGRGRGHPNGRPMQGRGMQ----PGIRGGMMPQQGPGVRPGFPPAGSRQMAP 163 >SB_45852| Best HMM Match : I-set (HMM E-Value=0) Length = 1122 Score = 26.6 bits (56), Expect = 9.5 Identities = 12/45 (26%), Positives = 22/45 (48%), Gaps = 1/45 (2%) Frame = -3 Query: 373 YVHHDTCYRR-HPDRTYEYHHHGHAEFGRQHVQYPMIQHWFGDQP 242 Y HH + H + +++HHH H H ++ +I G++P Sbjct: 1032 YHHHRRRHHHYHHQQQHQFHHHHHHTHYNYHYRHFLIIDRPGNKP 1076 >SB_50530| Best HMM Match : Pencillinase_R (HMM E-Value=3.3) Length = 356 Score = 26.6 bits (56), Expect = 9.5 Identities = 13/43 (30%), Positives = 18/43 (41%), Gaps = 1/43 (2%) Frame = -3 Query: 373 YVHHDTCYRRHPDRTYEYHHHGHAEFGRQ-HVQYPMIQHWFGD 248 Y H+D Y H Y+YH+H + H Y H+ D Sbjct: 299 YYHYDYYYHYHYYYYYDYHYHYDYHYHYDYHYDYHYDYHYHYD 341 >SB_46293| Best HMM Match : Keratin_B2 (HMM E-Value=0.00077) Length = 677 Score = 26.6 bits (56), Expect = 9.5 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -3 Query: 190 HH*PGPDGWAP*TRTGGAWLHPAPSHSSLNTPT 92 HH W T+T W HP + ++L PT Sbjct: 117 HHTKTQANWYHPTKTQANWYHPTKTQANLYHPT 149 >SB_45599| Best HMM Match : GRP (HMM E-Value=0.22) Length = 595 Score = 26.6 bits (56), Expect = 9.5 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 1/33 (3%) Frame = +1 Query: 277 TGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 372 +G ++ R PR RGGG G G G RGGR Sbjct: 501 SGSSIVRRPRRRRGGGGGGGGGGGGGGGGRGGR 533 >SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) Length = 237 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/32 (28%), Positives = 15/32 (46%) Frame = -3 Query: 352 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHW 257 +R+H +R +HHH H +P H+ Sbjct: 190 HRQHYNRHRRHHHHHRHRHHHHHPNHPYSHHY 221 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,684,011 Number of Sequences: 59808 Number of extensions: 283418 Number of successful extensions: 911 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 859 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -