BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0454 (450 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 186 8e-48 At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 184 3e-47 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 29 1.1 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 29 1.5 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 29 1.5 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 2.5 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 3.4 At5g01010.1 68418.m00001 expressed protein 28 3.4 At3g12430.1 68416.m01548 expressed protein ; expression supporte... 28 3.4 At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; g... 27 4.4 At1g80480.1 68414.m09427 PRLI-interacting factor L, putative sim... 27 4.4 At4g04920.1 68417.m00715 expressed protein 27 5.9 At4g01000.1 68417.m00135 ubiquitin family protein low similarity... 27 5.9 At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to... 27 5.9 At1g76010.1 68414.m08825 expressed protein 27 5.9 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 27 7.7 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 27 7.7 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 27 7.7 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 186 bits (452), Expect = 8e-48 Identities = 85/131 (64%), Positives = 102/131 (77%), Gaps = 2/131 (1%) Frame = +1 Query: 64 MSLSVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVS 237 M+ + ARPLV++ + + T Q + LP V AP+RPD+VN VH +S NSRQPY VS Sbjct: 1 MAAAAARPLVTIQTLDGDMSTDQSSTVVLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVS 60 Query: 238 KEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHRXV 417 K+AGHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWHR V Sbjct: 61 KKAGHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRV 120 Query: 418 NLRQRRAALAA 450 N+ +R A+ + Sbjct: 121 NVNMKRHAIVS 131 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 184 bits (447), Expect = 3e-47 Identities = 85/128 (66%), Positives = 98/128 (76%), Gaps = 2/128 (1%) Frame = +1 Query: 73 SVARPLVSVYSEKSE--TVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEA 246 + ARPLV+V + T Q LP V AP+RPD+VN VH +S NSRQPY VSK+A Sbjct: 5 AAARPLVTVQGLDGDMSTDQSTTVTLPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKA 64 Query: 247 GHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHRXVNLR 426 GHQTSAESWGTGRAV+RIPRV GGGTHR+GQ AFGNMCRGGRMFAPTK WRRWHR VN+ Sbjct: 65 GHQTSAESWGTGRAVSRIPRVPGGGTHRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVN 124 Query: 427 QRRAALAA 450 +R A+ + Sbjct: 125 MKRHAIVS 132 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 29.5 bits (63), Expect = 1.1 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +1 Query: 88 LVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 234 LV +++ SE+++ PLPF K+P +PD++ H + NS+ C+ Sbjct: 351 LVYLHAALSESMR-LYPPLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 379 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 260 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 379 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 260 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 2.5 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +1 Query: 139 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 234 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 Score = 27.5 bits (58), Expect = 4.4 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +1 Query: 139 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 234 P+PF K+P +PD++ H + NS+ +C+ Sbjct: 857 PVPFQHKSPTKPDVLPSGH-KVDANSKILFCL 887 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 3.4 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -3 Query: 367 HHDTCYRRHPDRTYEYHHHGHAEF 296 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At5g01010.1 68418.m00001 expressed protein Length = 409 Score = 27.9 bits (59), Expect = 3.4 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -1 Query: 264 STGLVTSLLAHAVGLPRVLGHRNVNIIDQVR-TDGRLEHEREGLG 133 +TG+ +L+ + VG+P+VL ++ I Q+ DG +E +RE G Sbjct: 203 ATGVYKTLVKYLVGVPQVL----LDFIRQINDDDGPMEEQRERYG 243 >At3g12430.1 68416.m01548 expressed protein ; expression supported by MPSS Length = 238 Score = 27.9 bits (59), Expect = 3.4 Identities = 12/40 (30%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 142 GAWLHPAPSHSSLNTPTLKVGLPID--SFRYFSEAIPLKY 29 G W+H SH+ ++ L VG+ + Y+S + P++Y Sbjct: 38 GQWIHDVLSHNRFSSHPLVVGVGVQWTPSSYYSASSPVRY 77 >At5g07520.1 68418.m00861 glycine-rich protein (GRP18) Oleosin; glycine-rich protein 18 (GRP18) PMID:11431566; Length = 228 Score = 27.5 bits (58), Expect = 4.4 Identities = 15/58 (25%), Positives = 25/58 (43%), Gaps = 3/58 (5%) Frame = +1 Query: 232 VSKEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQ---GAFGNMCRGGRMFAPTKPW 396 + + G + +AE + + + ++P G G G+ G FGN GG F W Sbjct: 81 IRRRMGAKPTAEGTSSAQPLLKLPVYGGYGGFWGGKKFSGTFGNKPGGGNPFGDISKW 138 >At1g80480.1 68414.m09427 PRLI-interacting factor L, putative similar to PRLI-interacting factor L [Arabidopsis thaliana] GI:11139268; contains Pfam profile PF02492: Cobalamin synthesis protein/P47K Length = 444 Score = 27.5 bits (58), Expect = 4.4 Identities = 9/28 (32%), Positives = 13/28 (46%) Frame = -3 Query: 367 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 284 HHD + H D +++ HH H H Sbjct: 311 HHDHDHDHHHDHNHDHDHHHHDGHDHHH 338 >At4g04920.1 68417.m00715 expressed protein Length = 1250 Score = 27.1 bits (57), Expect = 5.9 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +1 Query: 157 KAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAE-SWGTGRAVARIPRVRGG 318 K P D + + +S S S VS EA Q++A +WG+G RGG Sbjct: 403 KKPSDQDSSDAISLSCSPVSNFSAYVSPEAAAQSAATTTWGSGVTAVAFDPTRGG 457 >At4g01000.1 68417.m00135 ubiquitin family protein low similarity to SP|P13117 Ubiquitin. {Neurospora crassa}; contains Pfam profile PF00240: Ubiquitin family Length = 415 Score = 27.1 bits (57), Expect = 5.9 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 328 RSGQGAFGNMCRGGRMFAPTKPWRRWHRXVNLRQRR 435 R G+G FG++ RGG M A K + ++ RR Sbjct: 79 RGGKGGFGSLLRGGGMKAGQKKTNNFDACRDMSGRR 114 >At2g05520.1 68415.m00584 glycine-rich protein (GRP) identical to glycine-rich protein; atGRP (GI:259447) [Arabidopsis thaliana] Length = 145 Score = 27.1 bits (57), Expect = 5.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +1 Query: 274 GTGRAVARIPRVRGGGTHRSGQGAFGNMCRGG 369 G GR R +GGG + G G+ G+ CR G Sbjct: 88 GGGRYQGGGGRYQGGGGRQGGGGSGGSYCRHG 119 >At1g76010.1 68414.m08825 expressed protein Length = 350 Score = 27.1 bits (57), Expect = 5.9 Identities = 17/44 (38%), Positives = 19/44 (43%) Frame = +1 Query: 235 SKEAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRG 366 S+ G + G GR R R RGGG R G G F N G Sbjct: 302 SQGRGGYDGPQGRGRGRGRGRGGRGRGGG--RGGDGGFNNRSDG 343 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 26.6 bits (56), Expect = 7.7 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 343 HPD-RTYEYHHHGHAEFGRQHVQYPMIQHWFGDQPP 239 HP + + Y H H + QH+ +P FG Q P Sbjct: 57 HPSMQQFPYQHPMHQQQQPQHLPHPPHPQMFGQQQP 92 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 26.6 bits (56), Expect = 7.7 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 343 HPD-RTYEYHHHGHAEFGRQHVQYPMIQHWFGDQPP 239 HP + + Y H H + QH+ +P FG Q P Sbjct: 57 HPSMQQFPYQHPMHQQQQPQHLPHPPHPQMFGQQQP 92 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 26.6 bits (56), Expect = 7.7 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -3 Query: 343 HPD-RTYEYHHHGHAEFGRQHVQYPMIQHWFGDQPP 239 HP + + Y H H + QH+ +P FG Q P Sbjct: 57 HPSMQQFPYQHPMHQQQQPQHLPHPPHPQMFGQQQP 92 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,503,171 Number of Sequences: 28952 Number of extensions: 195580 Number of successful extensions: 695 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 641 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 683 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -