BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0450 (731 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57418| Best HMM Match : WD40 (HMM E-Value=4.5e-15) 110 1e-24 SB_35398| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 5e-16 SB_36905| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 >SB_57418| Best HMM Match : WD40 (HMM E-Value=4.5e-15) Length = 365 Score = 110 bits (264), Expect = 1e-24 Identities = 57/142 (40%), Positives = 80/142 (56%), Gaps = 12/142 (8%) Frame = +3 Query: 282 QAQTGAPCLSFDIVTDNLGNDRNEFPMTAYLVAGTQASSAHLNNLLVIKMSNLHP----- 446 +AQTGAPCLSFD++ DNLG R E+PMTAY++AGTQ+ + N+++V+KMS LH Sbjct: 62 EAQTGAPCLSFDVIPDNLGEARTEYPMTAYILAGTQSERSRANHIIVMKMSELHRTHDEE 121 Query: 447 -------ISKPXXXXXXXXXXXXXXXXXQKPQMTFSFIKHQGCVNRIRATNFKNSVLAAS 605 I + + P++ +KH G VNRIR + N + AS Sbjct: 122 KATQAICIRETFVSPNSDSDEEEDDYIDEDPELETVMLKHNGGVNRIRHGHIPNRHIVAS 181 Query: 606 WSELGRVDIWNITQQLQAVDDP 671 WSE G V IW++ Q+ A D+P Sbjct: 182 WSERGSVHIWDVEAQIIASDNP 203 >SB_35398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 81.8 bits (193), Expect = 5e-16 Identities = 33/54 (61%), Positives = 45/54 (83%) Frame = +3 Query: 282 QAQTGAPCLSFDIVTDNLGNDRNEFPMTAYLVAGTQASSAHLNNLLVIKMSNLH 443 +AQTGAPCLSFD++ DNLG R E+PMTAY++AGTQ+ + N+++V+KMS LH Sbjct: 62 EAQTGAPCLSFDVIPDNLGEARTEYPMTAYILAGTQSERSRANHIIVMKMSELH 115 >SB_36905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 563 Score = 27.9 bits (59), Expect = 9.0 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = +3 Query: 642 TQQLQAVDDPVVLERYNLETVSNPVKPIY 728 TQ LQ DP+V Y+ P KPIY Sbjct: 386 TQSLQRQRDPIVAPCYDAPKQGVPAKPIY 414 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,656,157 Number of Sequences: 59808 Number of extensions: 357326 Number of successful extensions: 866 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 823 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 862 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1962001171 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -