Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= Nnor0449
         (548 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

08_02_0707 - 20212190-20214592                                         27   9.9  

>08_02_0707 - 20212190-20214592
          Length = 800

 Score = 27.1 bits (57), Expect = 9.9
 Identities = 12/44 (27%), Positives = 20/44 (45%)
 Frame = -3

Query: 501 MFFCKIHLLCHDWCCNSFHRYYNEYHYCMMNSLRHHHGLHGFHN 370
           +FF + H   H   C+  H + + + +   +S  H HG    HN
Sbjct: 482 VFFHEEHHHAHGGSCSHSHSHSHSHSHSHSHSHSHVHGHEDHHN 525


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,332,532
Number of Sequences: 37544
Number of extensions: 152633
Number of successful extensions: 363
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 359
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 363
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1233951264
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)