BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0449 (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g11390.1 68416.m01387 DC1 domain-containing protein contains ... 33 0.13 At4g18335.1 68417.m02720 hypothetical protein 29 2.0 At1g69560.1 68414.m07999 myb family transcription factor (MYB105... 27 6.2 At1g21350.3 68414.m02671 expressed protein 27 6.2 >At3g11390.1 68416.m01387 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 710 Score = 33.1 bits (72), Expect = 0.13 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = -3 Query: 537 LCLNS*QSFHFDMFFCKIHLLCHDWCCNSFHRYYNEYHYCMMNSLRHHHGLHGF 376 L L S ++ FD F C+ H+ S Y+N ++YC + HHG H F Sbjct: 124 LSLRSGRNTKFDCFSCRKHM--------SPLTYHNYHYYCKTCDMEFHHGCHTF 169 >At4g18335.1 68417.m02720 hypothetical protein Length = 164 Score = 29.1 bits (62), Expect = 2.0 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = -3 Query: 444 RYYNEYHYCMMNSLRHHHGLH 382 RY ++Y+Y ++LRH GLH Sbjct: 83 RYNHQYYYYYRHTLRHRRGLH 103 >At1g69560.1 68414.m07999 myb family transcription factor (MYB105) contains Pfam profile: PF00249: Myb-like DNA-binding domain Length = 330 Score = 27.5 bits (58), Expect = 6.2 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 456 NSFHRYYNEYHYCMMNSLRHH 394 +S H +YN+ +C+M+ +HH Sbjct: 23 SSSHHHYNQQQHCIMSEDQHH 43 >At1g21350.3 68414.m02671 expressed protein Length = 252 Score = 27.5 bits (58), Expect = 6.2 Identities = 10/35 (28%), Positives = 20/35 (57%) Frame = -3 Query: 366 LDCYCLYKNLCIRYLYHHCSSLVHNNHDLGTTSNF 262 L+ + LY +L + ++ +HC ++H D+ NF Sbjct: 90 LEDFELYPSLLVMFICNHCPFVIHLKKDIVKLCNF 124 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,067,656 Number of Sequences: 28952 Number of extensions: 139755 Number of successful extensions: 343 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 337 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -