BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0442 (326 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 22 1.9 EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 pr... 21 4.3 AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 20 5.7 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 20 7.6 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 20 7.6 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 21.8 bits (44), Expect = 1.9 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = -2 Query: 133 RWRITGLWAIVTEASLLLSRCVTAGEIERRGPKPAPGATRSPPP 2 R R+ A+V E + G + GP+P P T PPP Sbjct: 175 RGRVAAAAAMVAETASFHHDAAGYG-LRNYGPEPVPS-TPYPPP 216 >EF125545-1|ABL73929.1| 274|Tribolium castaneum obstractor C1 protein. Length = 274 Score = 20.6 bits (41), Expect = 4.3 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = -2 Query: 40 PKPAPGATRSPPP 2 P+PAP + +P P Sbjct: 258 PRPAPASRNAPEP 270 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 20.2 bits (40), Expect = 5.7 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +1 Query: 124 SATYGRARSKSSNSPADETHSTQSAHR 204 SATY + + S SPA T HR Sbjct: 207 SATYTNSANSSIWSPASIDSFTLEQHR 233 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 19.8 bits (39), Expect = 7.6 Identities = 6/16 (37%), Positives = 12/16 (75%) Frame = +2 Query: 74 TGEKERCLCDYCPEAR 121 +GE+E + +CP+A+ Sbjct: 93 SGEREASVSLFCPKAK 108 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 19.8 bits (39), Expect = 7.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 222 GFHWLCRNRKKFLIKKD 272 G WL RN+K I+ D Sbjct: 511 GNPWLFRNQKDMFIELD 527 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 81,907 Number of Sequences: 336 Number of extensions: 1678 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6261139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -