BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0433 (423 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40594| Best HMM Match : Extensin_2 (HMM E-Value=0.083) 140 3e-34 SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) 36 0.014 SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.014 SB_45463| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.52 SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.52 SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.52 SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.69 SB_8854| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.69 SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.69 SB_16971| Best HMM Match : zf-C2H2 (HMM E-Value=5.8e-36) 30 0.91 SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 0.91 SB_50183| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 1.2 SB_42899| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_34420| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 1.2 SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) 29 2.1 SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) 29 2.1 SB_13281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.8 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 3.7 SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.7 SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 3.7 SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 4.8 SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) 27 4.8 SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 4.8 SB_20696| Best HMM Match : Gam (HMM E-Value=2.1) 27 4.8 SB_11362| Best HMM Match : zf-C2H2 (HMM E-Value=7.9e-32) 27 4.8 SB_43| Best HMM Match : Motile_Sperm (HMM E-Value=0.61) 27 4.8 SB_32644| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 6.4 SB_14666| Best HMM Match : NHL (HMM E-Value=4.5) 27 6.4 SB_1799| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 6.4 SB_1728| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 6.4 SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) 27 6.4 SB_40339| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 6.4 SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 6.4 SB_8757| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 6.4 SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 8.5 SB_32903| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 SB_19824| Best HMM Match : zf-C2H2 (HMM E-Value=1.4e-26) 27 8.5 SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.5 >SB_40594| Best HMM Match : Extensin_2 (HMM E-Value=0.083) Length = 440 Score = 140 bits (340), Expect = 3e-34 Identities = 62/97 (63%), Positives = 76/97 (78%), Gaps = 1/97 (1%) Frame = +1 Query: 133 VGRRRRHP-NLGAGIVTGQFDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 309 +GR+++ P FDDEKILIQHQKAKHFKC ICHKKLYTGPGL+IHC QVHKE Sbjct: 1 MGRKKKKPMKPWCWYCNRDFDDEKILIQHQKAKHFKCMICHKKLYTGPGLAIHCTQVHKE 60 Query: 310 AIDKVPNSLPNRSNIEIEIYGMEGIPPEDVKEHEKQK 420 + +PNSLPNR + EIEIYGMEGIP +D+KE ++++ Sbjct: 61 TVSAIPNSLPNRGDPEIEIYGMEGIPEKDLKERQQRQ 97 Score = 46.0 bits (104), Expect = 1e-05 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +3 Query: 129 MGRKKKKASKPWCWYCNR 182 MGRKKKK KPWCWYCNR Sbjct: 1 MGRKKKKPMKPWCWYCNR 18 >SB_10357| Best HMM Match : zf-C2H2 (HMM E-Value=9.8e-38) Length = 509 Score = 35.9 bits (79), Expect = 0.014 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 H K K FKCHICH++ ++ H M++H Sbjct: 421 HSKEKPFKCHICHRRFAQSSSVTTH-MRIH 449 >SB_34562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 978 Score = 35.9 bits (79), Expect = 0.014 Identities = 22/69 (31%), Positives = 33/69 (47%) Frame = +1 Query: 193 DEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSLPNRSNIEIEIYG 372 D I + H + K FKC CHK + H + H +A P+S ++S+ E Sbjct: 286 DLHIKVVHNRVKAFKCEHCHKVFGHSFDRARHVKKFHSDAKPVTPSSQSDQSHELSE--A 343 Query: 373 MEGIPPEDV 399 +EGI +DV Sbjct: 344 IEGIQNKDV 352 >SB_45463| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 347 Score = 30.7 bits (66), Expect = 0.52 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +1 Query: 208 IQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 309 + H K FKCHIC K + L+ H M H E Sbjct: 276 LTHTGEKPFKCHICGKAFHQVYNLTFH-MHTHNE 308 >SB_15809| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 30.7 bits (66), Expect = 0.52 Identities = 17/65 (26%), Positives = 25/65 (38%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSLPNRSNIEIEIYGMEGIPPE 393 H K F+C +CHK LS H VH++ + P P + G + P Sbjct: 478 HTGEKPFECPVCHKAFSQTGNLSKHVRYVHEK--QQRPKEKPRDKKYFCSLCGKAFLCPS 535 Query: 394 DVKEH 408 + H Sbjct: 536 SLSMH 540 >SB_11426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 30.7 bits (66), Expect = 0.52 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = +1 Query: 190 DDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSLPNRSNIE 357 DDEK +H K F C C+K + H VHKE+ N + ++E Sbjct: 294 DDEKPE-RHTTEKLFDCCYCNKNFTAARSVRRHIRAVHKESRSSPENKKSEKKSLE 348 >SB_39159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 30.3 bits (65), Expect = 0.69 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 309 H+K K +KC +C K LS H VH++ Sbjct: 658 HKKEKPYKCDVCKKIFGLSSSLSRHIRTVHQD 689 >SB_8854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 339 Score = 30.3 bits (65), Expect = 0.69 Identities = 17/63 (26%), Positives = 27/63 (42%), Gaps = 2/63 (3%) Frame = +1 Query: 205 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSL--PNRSNIEIEIYGME 378 ++ H K +KC IC+ K + L H H DK N + PN I ++ + Sbjct: 270 ILTHTGEKPYKCSICNWKFISSSNLRTHIRIHHSYFTDKAGNQVTQPNGKPINPDLAKPD 329 Query: 379 GIP 387 +P Sbjct: 330 TMP 332 >SB_55441| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 30.3 bits (65), Expect = 0.69 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 309 H + +KC IC KK GLSIH ++H E Sbjct: 483 HTDERPYKCDICGKKFRQQGGLSIH-KKIHTE 513 Score = 27.1 bits (57), Expect = 6.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 H K ++C IC K L+IH M++H Sbjct: 539 HSGEKPYRCEICEKSFRDKDSLNIH-MRIH 567 >SB_16971| Best HMM Match : zf-C2H2 (HMM E-Value=5.8e-36) Length = 477 Score = 29.9 bits (64), Expect = 0.91 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 202 ILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 +L H+K + +CH+C K+ L+ H M+VH Sbjct: 294 VLHVHEKHRPHECHVCQKRFSQSSSLNKH-MRVH 326 >SB_44730| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1346 Score = 29.9 bits (64), Expect = 0.91 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = +1 Query: 205 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 306 ++ H + + F C C K L HCM VH+ Sbjct: 1188 IVTHSEQRPFSCEQCMKSFNRSGDLRRHCMTVHE 1221 >SB_50183| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 717 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 205 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 L++H K FKC C K ++ L IH ++VH Sbjct: 508 LLKHTGEKKFKCAHCPKTFFSSSSLKIH-VRVH 539 >SB_42899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 490 Score = 29.5 bits (63), Expect = 1.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 202 ILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 +L H+K + +CH+C K+ L+ H M+VH Sbjct: 305 VLHVHEKHRPHECHVCKKRFSQSSSLNKH-MRVH 337 >SB_34420| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 544 Score = 29.5 bits (63), Expect = 1.2 Identities = 19/45 (42%), Positives = 19/45 (42%), Gaps = 5/45 (11%) Frame = +1 Query: 187 FDDEKILIQHQKAKH-----FKCHICHKKLYTGPGLSIHCMQVHK 306 FD L HQK H FKC C K LY L H VHK Sbjct: 296 FDSYNQLHNHQKTIHGGKNPFKCGHCGKCLYNESYLKEHIRGVHK 340 >SB_38457| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 4303 Score = 29.5 bits (63), Expect = 1.2 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 309 H+ K KC+ C KK++T G+ H QVH + Sbjct: 521 HRDEKLVKCNYC-KKIFTKYGMKEHIEQVHNK 551 Score = 27.9 bits (59), Expect = 3.7 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 306 H++++ ++C C L + L++H ++HK Sbjct: 2391 HERSRPYRCEYCGWHLASKSNLTLHIKRIHK 2421 Score = 26.6 bits (56), Expect = 8.5 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 196 EKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 309 E + + H+K K + C C K+ T L H H + Sbjct: 459 EHVKVSHEKVKIYVCDHCDKEFETSCQLGSHKKVAHDQ 496 >SB_27848| Best HMM Match : zf-C2H2 (HMM E-Value=1.49995e-41) Length = 257 Score = 28.7 bits (61), Expect = 2.1 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 205 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 309 +I H K F+C++C K LS H M +H + Sbjct: 138 MIVHSNRKPFQCNVCEKAFKRSSTLSTH-MLIHSD 171 >SB_57| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1498 Score = 28.7 bits (61), Expect = 2.1 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = +1 Query: 187 FDDEKILIQHQKA----KHFKCHICHKKLYTGPGLSIHCMQVHKEA 312 F L++HQ++ + F C +C K L T L H M HK++ Sbjct: 1185 FSTHVYLVEHQESVLGEREFTCEVCDKSLLTRAHLKRHTMN-HKKS 1229 >SB_13281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 477 Score = 28.3 bits (60), Expect = 2.8 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 217 QKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 309 Q + F CH+C++ L IH + VH++ Sbjct: 331 QGDRKFPCHLCNRSFEKRDRLRIHILHVHEK 361 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 27.9 bits (59), Expect = 3.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 205 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 L+ H K FKC +C K GL H +++H Sbjct: 469 LMMHSGQKPFKCDVCDKGFTRHAGLKSH-LRIH 500 >SB_28794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 27.9 bits (59), Expect = 3.7 Identities = 8/46 (17%), Positives = 23/46 (50%) Frame = -1 Query: 420 FLFLMFFHIFRGYTFHSINFYFYI*PIWQ*IWYFVYGFFMYLHAVY 283 + + +++ + Y +H +Y+Y + +Y+ Y ++ Y + Y Sbjct: 116 YYYYYYYYYYYYYYYHHYYYYYYYYYYYYYYYYYYYYYYYYYYYYY 161 >SB_16305| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1122 Score = 27.9 bits (59), Expect = 3.7 Identities = 18/53 (33%), Positives = 27/53 (50%) Frame = +1 Query: 199 KILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSLPNRSNIE 357 K + H+ K ++C C K LSIH + HKE VP P+RS+++ Sbjct: 917 KHMRSHKDFKPYRCDKCDKSFNQSRLLSIHSL-THKEK-KTVPK--PSRSSVD 965 >SB_23259| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1449 Score = 27.9 bits (59), Expect = 3.7 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = +1 Query: 202 ILIQHQKAKHFKCHICHKKLYTGPGLSIH 288 + + H + F+C ICHK + L+ H Sbjct: 989 VRVHHTHERPFQCQICHKSFHMAGDLTKH 1017 >SB_51905| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 928 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 H AK FKC C K + L+ H VH Sbjct: 866 HSGAKPFKCDTCEKAFRSSSELTRHVKLVH 895 >SB_46179| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4856 Score = 27.5 bits (58), Expect = 4.8 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 307 EAIDKVPNSLPNRSNIEIEIYGMEGIPPEDVKEHEKQKS 423 EA+D+ S+ R ++E ++ G E PP +EHE S Sbjct: 4771 EALDEQIKSVFRRPSME-DLLGAEDFPPPPTEEHETTDS 4808 >SB_37930| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 27.5 bits (58), Expect = 4.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 190 DDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 D + ++ H K K F C C+K T L +H ++VH Sbjct: 115 DLRRHMLTHTKEKPFACSTCNKAFATKQTLIVH-IRVH 151 >SB_21010| Best HMM Match : PHD (HMM E-Value=7e-10) Length = 389 Score = 27.5 bits (58), Expect = 4.8 Identities = 15/74 (20%), Positives = 30/74 (40%), Gaps = 2/74 (2%) Frame = +1 Query: 145 RRHPNLGAGIVTGQFDDEKI--LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAID 318 R P ++ E++ + + K + C IC ++ GPGL H + + D Sbjct: 170 RPSPLFSGSMIVRNITKEELARMTPEDRKKPYVCEICGRRYKNGPGLKYHYTHYNHDQ-D 228 Query: 319 KVPNSLPNRSNIEI 360 N+ + +I + Sbjct: 229 NTSNAAQDDHSISL 242 >SB_32609| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1741 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +1 Query: 226 KHFKCHICHKKLYTGPGLSIH 288 K FKC IC K+ T GL+ H Sbjct: 1303 KLFKCDICEKEFKTHVGLNFH 1323 >SB_20696| Best HMM Match : Gam (HMM E-Value=2.1) Length = 252 Score = 27.5 bits (58), Expect = 4.8 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = +1 Query: 280 SIHCMQVHKEAIDKVPNSLPNRSNIEIEIYGMEGIPPEDVK 402 S+H Q+ I+ + + + N+S E I M G+PPED K Sbjct: 94 SVHVTQLGTN-IEHIASCVQNKSTAE-RIRRMRGLPPEDSK 132 >SB_11362| Best HMM Match : zf-C2H2 (HMM E-Value=7.9e-32) Length = 382 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 199 KILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 306 KI + + ++CH+C + G GL+ H HK Sbjct: 324 KITHEGGELAKYECHLCGARYTRGTGLTSHLKAKHK 359 >SB_43| Best HMM Match : Motile_Sperm (HMM E-Value=0.61) Length = 662 Score = 27.5 bits (58), Expect = 4.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 334 LPNRSNIEIEIYGMEGIPPEDVKEHEKQK 420 LP+ + EI + GM PP + EH +QK Sbjct: 120 LPHGPDYEIPLRGMVAQPPAPIDEHIQQK 148 >SB_32644| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 365 Score = 27.1 bits (57), Expect = 6.4 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = +1 Query: 190 DDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 D +K+ ++ + F C C K T GL +H + H Sbjct: 182 DRKKLKLESESQDTFDCMSCKKVFSTPHGLEVHVRRSH 219 >SB_14666| Best HMM Match : NHL (HMM E-Value=4.5) Length = 151 Score = 27.1 bits (57), Expect = 6.4 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = +2 Query: 215 IRKRSILNVTFVTKSCTQDLDCPYTACRYIKKP*TKY 325 IR+ +++++TF + S +L P+ CR K P T Y Sbjct: 27 IRQVTVVDLTFTSDSEECNLKSPFGICRSHKDPYTLY 63 >SB_1799| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 907 Score = 27.1 bits (57), Expect = 6.4 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 309 H + F+C +C K L HC + H + Sbjct: 258 HTNERLFQCDLCEKAFIDRADLRRHCQRTHSD 289 >SB_1728| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 935 Score = 27.1 bits (57), Expect = 6.4 Identities = 19/73 (26%), Positives = 32/73 (43%) Frame = +1 Query: 202 ILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSLPNRSNIEIEIYGMEG 381 ++ Q K FKC +C K T L H +++H K S+ R N + + E Sbjct: 797 VIHQGNKRFKFKCDVCDKMFRTRSHLRDH-VRIHTGQSTKPMRSI-FRCNYCFKTFSKEE 854 Query: 382 IPPEDVKEHEKQK 420 +EH++Q+ Sbjct: 855 SYRSHCEEHKQQR 867 >SB_46756| Best HMM Match : zf-C2H2 (HMM E-Value=4.60046e-42) Length = 1078 Score = 27.1 bits (57), Expect = 6.4 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 205 LIQHQKAKHFKCHICH 252 +++H K F+CHICH Sbjct: 361 VLKHPNYKAFECHICH 376 >SB_40339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 27.1 bits (57), Expect = 6.4 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 6/45 (13%) Frame = +2 Query: 209 SNIRKRSILNVTFVTKSCTQDLDC---PYTACRYI---KKP*TKY 325 SN+ R+I V+ + KSCT + C P T RY+ K P T Y Sbjct: 3 SNLAGRTIEEVSEIIKSCTDRVICTVKPSTDFRYVDTHKTPDTDY 47 >SB_37978| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 487 Score = 27.1 bits (57), Expect = 6.4 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +1 Query: 211 QHQKAKHFKCHICHKKLYTGPGLSIHCMQVHK 306 Q++K K FKC C K L H M +HK Sbjct: 284 QNEKLKKFKCPTCDKAFIRNYTLQCH-MLIHK 314 >SB_34111| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 757 Score = 27.1 bits (57), Expect = 6.4 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = +1 Query: 205 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE 309 +++H K F C +C ++ L++H +VH E Sbjct: 545 MMRHDGVKPFSCPLCTQRFVNQSALNVH-QKVHSE 578 >SB_8757| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 539 Score = 27.1 bits (57), Expect = 6.4 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = +1 Query: 211 QHQKAKHFKCHICHKKLYTGPGLSIH 288 +H KHFKC C+K+ + H Sbjct: 262 RHSNEKHFKCSYCNKRFVESGDMRKH 287 >SB_43276| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 426 Score = 26.6 bits (56), Expect = 8.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 205 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 L+ H K +KC +C K GL H +++H Sbjct: 282 LMMHSGQKPYKCDVCDKGFTRHAGLKSH-LRIH 313 >SB_32903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 26.6 bits (56), Expect = 8.5 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 H + ++F C IC+K + L H VH Sbjct: 410 HVEERNFPCEICNKAYTSDANLKAHKRSVH 439 >SB_19824| Best HMM Match : zf-C2H2 (HMM E-Value=1.4e-26) Length = 550 Score = 26.6 bits (56), Expect = 8.5 Identities = 16/51 (31%), Positives = 23/51 (45%), Gaps = 1/51 (1%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDK-VPNSLPNRSNIEIE 363 H K F C C+KK LS H ++ H +K P S+ + I I+ Sbjct: 410 HTGEKRFTCPECNKKFMRSDHLSKH-VKTHSNGKNKTAPTSVKTQDPIPIQ 459 >SB_3588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 391 Score = 26.6 bits (56), Expect = 8.5 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 205 LIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVH 303 L+ H K +KC +C K GL H +++H Sbjct: 247 LMMHSGQKPYKCDVCDKGFTRHAGLKSH-LRIH 278 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,856,919 Number of Sequences: 59808 Number of extensions: 220898 Number of successful extensions: 839 Number of sequences better than 10.0: 43 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 830 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 801830705 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -