BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0433 (423 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 0.65 L10441-1|AAA29361.1| 154|Anopheles gambiae transposase protein. 24 2.6 L10438-1|AAA29359.1| 154|Anopheles gambiae transposase protein. 24 2.6 AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor... 23 3.5 X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein... 23 4.6 CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein... 23 6.0 AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease pr... 23 6.0 AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein p... 23 6.0 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 0.65 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGPGLSIHCMQVHKEAIDKVPNSL 336 H+ H +C +C +K + HC H E D+ N + Sbjct: 918 HRPQSH-ECPVCGQKFTRRDNMKAHCKVKHPELRDRFYNHI 957 >L10441-1|AAA29361.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 23.8 bits (49), Expect = 2.6 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = -1 Query: 276 SRSCVQLFVTNVTFKMLRFLMLDENLFVVKLPCYNTSTKVW 154 S+ C++LF N + + R++ +DE P N + W Sbjct: 12 SQQCLELFERNNSEFLRRYVTMDETWLHHYTPKSNRQSSEW 52 >L10438-1|AAA29359.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 23.8 bits (49), Expect = 2.6 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = -1 Query: 276 SRSCVQLFVTNVTFKMLRFLMLDENLFVVKLPCYNTSTKVW 154 S+ C++LF N + + R++ +DE P N + W Sbjct: 12 SQQCLELFERNNSEFLRRYVTMDETWLHHYTPKSNRQSSEW 52 >AY825645-1|AAV70208.1| 168|Anopheles gambiae olfactory receptor GPRor70 protein. Length = 168 Score = 23.4 bits (48), Expect = 3.5 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 201 LFVVKLPCYNTSTKV 157 LF+ +LPCY+ ST + Sbjct: 80 LFLYELPCYDWSTTI 94 >X87411-1|CAA60858.1| 599|Anopheles gambiae maltase-like protein Agm2 protein. Length = 599 Score = 23.0 bits (47), Expect = 4.6 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 174 NTSTKVWMPSSSSYP 130 N S K W+P ++ YP Sbjct: 439 NASVKPWLPLATDYP 453 >CR954257-11|CAJ14162.1| 415|Anopheles gambiae predicted protein protein. Length = 415 Score = 22.6 bits (46), Expect = 6.0 Identities = 8/23 (34%), Positives = 10/23 (43%) Frame = +1 Query: 235 KCHICHKKLYTGPGLSIHCMQVH 303 KC ICHK +H +H Sbjct: 382 KCTICHKLFSQRQDYQLHMRAIH 404 >AJ271117-1|CAB88872.1| 355|Anopheles gambiae serine protease protein. Length = 355 Score = 22.6 bits (46), Expect = 6.0 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +2 Query: 281 PYTACRYIKKP*TKYQIHC 337 P+TA +KP +Y HC Sbjct: 115 PWTALIEYRKPGNQYDFHC 133 >AB090818-1|BAC57911.1| 285|Anopheles gambiae gag-like protein protein. Length = 285 Score = 22.6 bits (46), Expect = 6.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 214 HQKAKHFKCHICHKKLYTGP 273 H K + KCH C + + GP Sbjct: 228 HGKDRSSKCHRCAEDKHEGP 247 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 414,817 Number of Sequences: 2352 Number of extensions: 8393 Number of successful extensions: 17 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 35060166 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -