BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0429 (413 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0159 + 5105272-5106360,5107605-5107769 28 3.4 04_03_0882 + 20535238-20535269,20535406-20535486,20535847-205359... 27 7.8 >09_02_0159 + 5105272-5106360,5107605-5107769 Length = 417 Score = 27.9 bits (59), Expect = 3.4 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 69 NLHDKVIFFKIVLNIKVVFSYYGLILMINIAFYLL 173 NL D+V FFK L +K F+Y ++ + + Y L Sbjct: 126 NLLDQVRFFKAELWVKFYFNYVPVVYLSEASIYAL 160 >04_03_0882 + 20535238-20535269,20535406-20535486,20535847-20535903, 20535991-20536054,20536326-20536532,20536838-20536891, 20536933-20537052 Length = 204 Score = 26.6 bits (56), Expect = 7.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +3 Query: 96 KIVLNIKVVFSYYGLILMINIAFYLLIRL*FRK*LWFP 209 +I+L I V+F +L I Y +RL F LW+P Sbjct: 38 RIILVILVIFDDIAGVLTSKIPMYSELRLAFLVYLWYP 75 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,861,871 Number of Sequences: 37544 Number of extensions: 126166 Number of successful extensions: 211 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 208 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 211 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 742607976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -