BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0426 (715 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0249 + 27868897-27871599 30 2.1 01_05_0028 - 17337455-17337664,17338407-17338697,17339926-173402... 30 2.1 >01_06_0249 + 27868897-27871599 Length = 900 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 485 STYSNDHHHQVKSRQYIWTSLNSKYWFTESMACLV 381 STY HHH+ Q I L+ Y FT + C+V Sbjct: 117 STYIGHHHHRYSITQTISFILDGYYSFTSNDLCMV 151 >01_05_0028 - 17337455-17337664,17338407-17338697,17339926-17340218, 17340812-17340959,17341177-17341219,17341985-17342307 Length = 435 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 343 ALFNFLVFYQFNGTRQAILSVNQYFEFKLVQMY 441 A NF V Y +G +++ S++QYFEF LV ++ Sbjct: 328 AALNFFVNYA-DGAVESLWSIDQYFEFVLVLLF 359 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,784,602 Number of Sequences: 37544 Number of extensions: 213928 Number of successful extensions: 511 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1851002996 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -