BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0426 (715 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 25 1.8 AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding pr... 23 9.5 AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding pr... 23 9.5 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 25.4 bits (53), Expect = 1.8 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +1 Query: 487 GYYVACNPNSFVHFESFYSRDIHNQTQKRNENETLTCKTKKK 612 G Y A NP + +S + + N+NETL+C T ++ Sbjct: 1149 GRYEARNPAYQRTTKDLFSGNQQRTQELVNQNETLSCYTSRR 1190 >AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding protein AgamOBP31 protein. Length = 313 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +1 Query: 514 SFVHFESFYSRDIHNQTQKRNENETLTCKTKKKI 615 S +H FY RD+ + ET C+ + ++ Sbjct: 205 SGIHLSRFYVRDLEVNDLRYLSKETKACRDRVRM 238 >AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding protein 1 protein. Length = 304 Score = 23.0 bits (47), Expect = 9.5 Identities = 9/34 (26%), Positives = 16/34 (47%) Frame = +1 Query: 514 SFVHFESFYSRDIHNQTQKRNENETLTCKTKKKI 615 S +H FY RD+ + ET C+ + ++ Sbjct: 205 SGIHLSRFYVRDLEVNDLRYLSKETKACRDRVRM 238 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 550,351 Number of Sequences: 2352 Number of extensions: 9221 Number of successful extensions: 63 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 62 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -