BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0423 (623 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g02970.1 68416.m00292 phosphate-responsive 1 family protein s... 30 1.1 At2g42850.1 68415.m05306 cytochrome P450 family protein similar ... 29 3.3 At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing ... 28 5.8 At5g54290.1 68418.m06762 cytochrome c biogenesis protein family ... 27 7.7 >At3g02970.1 68416.m00292 phosphate-responsive 1 family protein similar to phi-1 (phosphate-induced gene) [Nicotiana tabacum] GI:3759184; contains Pfam profile PF04674: Phosphate-induced protein 1 conserved region Length = 332 Score = 30.3 bits (65), Expect = 1.1 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +1 Query: 22 KMTSTPFNVGLNDGARLSSRVLRPPGGGHTNIFDSEPEPPRTGRRAVPPSATSTF-SHG 195 K +TP+N + SS + P T +F S P TGR V P F SHG Sbjct: 251 KSETTPYNDDVKKNHESSSMYIVDPATKCTRVFGSGAFPGFTGRIRVDPITGGAFNSHG 309 >At2g42850.1 68415.m05306 cytochrome P450 family protein similar to taxane 13-alpha-hydroxylase (GI:17148242) {Taxus cuspidata} Length = 485 Score = 28.7 bits (61), Expect = 3.3 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +3 Query: 381 QGPPRRVLLGLVVNRTAPVGCESVQSNLXFSFNSHYVTNMYRG 509 QG RVL G+V N + +G ES+ L + H+ T +RG Sbjct: 136 QGEKHRVLRGIVANSLSYIGLESLIPKLCDTVKFHHETE-WRG 177 >At1g78260.1 68414.m09120 RNA recognition motif (RRM)-containing protein similar to RNA recognition motif-containing protein SEB-4 GI:8895698 from [Xenopus laevis]; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 287 Score = 27.9 bits (59), Expect = 5.8 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 35 HHSTLASMTELVYQAGCS-APPVVATLTSSIPNRSHRGPGAVPFHQAQRALSATD 196 HH +S + LVY + S APP+ L+SS S P VP + + +A + Sbjct: 223 HHQRFSSPSFLVYPSNSSFAPPLQGVLSSS--TESEAVPQQVPAAEGEATTTAPE 275 >At5g54290.1 68418.m06762 cytochrome c biogenesis protein family low similarity to cytochrome c biogenesis protein CcdA [Paracoccus pantotrophus] GI:11095328; contains Pfam profile PF02683: Cytochrome C biogenesis protein transmembrane region Length = 354 Score = 27.5 bits (58), Expect = 7.7 Identities = 14/30 (46%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -1 Query: 215 AFGSSPC--PWLKVLVALGGTARRPVLGGS 132 A +SPC P L L+ T+R PV+GGS Sbjct: 261 ALAASPCSTPVLATLLGYVATSRDPVIGGS 290 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,920,284 Number of Sequences: 28952 Number of extensions: 221680 Number of successful extensions: 671 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 646 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 670 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1265787216 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -