BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0410 (726 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 24 1.4 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 24 1.4 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 23 1.9 S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subu... 22 4.4 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 4.4 AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor su... 21 7.7 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.8 bits (49), Expect = 1.4 Identities = 12/50 (24%), Positives = 20/50 (40%) Frame = -3 Query: 286 HTSANHAWLASKSMGQARNNLGPTVTSLEECASRNAFNVDQTPGSHSNTV 137 H S H W + ++ GP + + E + +A D SH T+ Sbjct: 170 HNSGTHFWHSHSGFQRSDGTFGPFIVRVPEEDNPHAKLYDYDLSSHVITI 219 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 23.8 bits (49), Expect = 1.4 Identities = 9/16 (56%), Positives = 13/16 (81%) Frame = -3 Query: 370 STAACLLRPYNATPSR 323 +T LL+PY+ATP+R Sbjct: 8 ATIITLLQPYDATPAR 23 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 23.4 bits (48), Expect = 1.9 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 724 TYLALNDYILNKCSYCLVRIKKSSYL*SIESYNSF 620 +++ALND C C + +K SY+ N+F Sbjct: 263 SWIALNDDYNRLCHLCFLLDEKLSYIILTSFLNNF 297 >S78567-1|AAB34900.1| 141|Tribolium castaneum GABA receptor subunit protein. Length = 141 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +1 Query: 37 QIIWNRSKDFWLGTCVGNYSRWSCD 111 +++ +R + + GNYSR +C+ Sbjct: 36 KVLGHRQRAMEISLTTGNYSRLACE 60 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = +3 Query: 531 QEAANYSGNQSQDSDNASMDSN 596 Q+ +NYS N D + D N Sbjct: 84 QQNSNYSSNSKPDCSKGNADQN 105 >AF025669-1|AAB81523.1| 243|Tribolium castaneum GABA receptor subunit protein. Length = 243 Score = 21.4 bits (43), Expect = 7.7 Identities = 7/25 (28%), Positives = 15/25 (60%) Frame = +1 Query: 37 QIIWNRSKDFWLGTCVGNYSRWSCD 111 +++ +R + + GNYSR +C+ Sbjct: 218 KVLGHRRRAVEISLTTGNYSRLACE 242 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 175,419 Number of Sequences: 336 Number of extensions: 3909 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19363530 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -