BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0408 (434 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase p... 133 9e-34 AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase p... 133 9e-34 AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 21 6.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 7.9 >AY568009-1|AAS73299.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 133 bits (321), Expect = 9e-34 Identities = 60/74 (81%), Positives = 69/74 (93%) Frame = +1 Query: 211 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 390 MS LADPVAFAKDFLAGG++AA+SKT VAPIERVKLLLQVQH+SKQI+ +QRYKG++D F Sbjct: 1 MSGLADPVAFAKDFLAGGVAAAISKTTVAPIERVKLLLQVQHISKQISEEQRYKGMIDCF 60 Query: 391 VRIPKEQGLLSFWR 432 VRIPKEQG LS+WR Sbjct: 61 VRIPKEQGFLSYWR 74 >AY332626-1|AAQ24500.1| 300|Apis mellifera ADP/ATP translocase protein. Length = 300 Score = 133 bits (321), Expect = 9e-34 Identities = 60/74 (81%), Positives = 69/74 (93%) Frame = +1 Query: 211 MSNLADPVAFAKDFLAGGISAAVSKTAVAPIERVKLLLQVQHVSKQIAADQRYKGIVDAF 390 MS LADPVAFAKDFLAGG++AA+SKT VAPIERVKLLLQVQH+SKQI+ +QRYKG++D F Sbjct: 1 MSGLADPVAFAKDFLAGGVAAAISKTTVAPIERVKLLLQVQHISKQISEEQRYKGMIDCF 60 Query: 391 VRIPKEQGLLSFWR 432 VRIPKEQG LS+WR Sbjct: 61 VRIPKEQGFLSYWR 74 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 21.0 bits (42), Expect = 6.0 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 136 VIPHPRVPQLPPRHIHLVKIT 198 +I P +LPP H H +T Sbjct: 92 IITIPPTRKLPPLHPHTAMVT 112 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 20.6 bits (41), Expect = 7.9 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +1 Query: 334 HVSKQIAADQRYKGIVDAFVRIPK 405 ++ K IAA +KG+ RIP+ Sbjct: 763 YIQKMIAAAAPFKGMETQDYRIPE 786 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,826 Number of Sequences: 438 Number of extensions: 2353 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 11368164 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -