BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0407 (420 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5CRP4 Cluster: Nuclear VCP like protein with 2 AAA ATp... 31 7.2 UniRef50_Q6LFH4 Cluster: Citrate synthase-like protein, putative... 31 9.5 >UniRef50_Q5CRP4 Cluster: Nuclear VCP like protein with 2 AAA ATpase domains; n=2; Cryptosporidium|Rep: Nuclear VCP like protein with 2 AAA ATpase domains - Cryptosporidium parvum Iowa II Length = 695 Score = 31.5 bits (68), Expect = 7.2 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +3 Query: 24 RVLLAS*TSKPTIHKPSKMKPHRL*RFVYKPLFN 125 +V + + T++P I P+ M+P RL R +Y PL N Sbjct: 544 KVFVVAATNRPDIIDPAMMRPGRLDRIIYVPLPN 577 >UniRef50_Q6LFH4 Cluster: Citrate synthase-like protein, putative; n=1; Plasmodium falciparum 3D7|Rep: Citrate synthase-like protein, putative - Plasmodium falciparum (isolate 3D7) Length = 465 Score = 31.1 bits (67), Expect = 9.5 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +1 Query: 196 DDFKFYCLKYNIFIKNSVLK*FHSKSRNNKYKVT*IYLY 312 +DF CL +N +IK++ LK K +N+K + IY Y Sbjct: 197 NDFVSSCLLFNFYIKSNCLKEKIKKEKNDKIVMNNIYNY 235 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 329,654,431 Number of Sequences: 1657284 Number of extensions: 5065472 Number of successful extensions: 9317 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9299 length of database: 575,637,011 effective HSP length: 93 effective length of database: 421,509,599 effective search space used: 19389441554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -