BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0407 (420 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 23 1.1 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 22 3.2 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 20 9.9 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 20 9.9 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/39 (25%), Positives = 21/39 (53%) Frame = +3 Query: 300 NIFILIQQNGSKNSFTLEGIWNSIMCDPHYCNSRYLLRL 416 +I Q +K+S+T+ G+ +I H+C Y +++ Sbjct: 433 SIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKV 471 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.8 bits (44), Expect = 3.2 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -3 Query: 280 YCAIWNEII 254 YCA WNE + Sbjct: 573 YCAFWNEFL 581 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 20.2 bits (40), Expect = 9.9 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = -2 Query: 398 AVAVMRVAHNAIPYSFQCERVFTAILLY*YKYIYVTLYLLL 276 AVA + H P R T ILL Y+ +LLL Sbjct: 532 AVACLLFHHRDTPVVRASGRELTIILLAGVLVCYLNTFLLL 572 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 20.2 bits (40), Expect = 9.9 Identities = 14/41 (34%), Positives = 17/41 (41%) Frame = -2 Query: 398 AVAVMRVAHNAIPYSFQCERVFTAILLY*YKYIYVTLYLLL 276 AVA + H P R T ILL Y+ +LLL Sbjct: 622 AVACLLFHHRDTPVVRASGRELTIILLAGVLVCYLNTFLLL 662 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,928 Number of Sequences: 438 Number of extensions: 1771 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10750329 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -