BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0405 (700 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0098 - 1008936-1011185,1011383-1012271,1012336-1013420 31 0.88 10_08_0912 - 21520088-21520426,21520534-21520674,21521235-215212... 29 4.7 >04_01_0098 - 1008936-1011185,1011383-1012271,1012336-1013420 Length = 1407 Score = 31.1 bits (67), Expect = 0.88 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +1 Query: 109 DKSIADNVFSSYDGCIQKKFCEVRSNVQLRIGFKT 213 DK I D CI K E SNVQ IG+KT Sbjct: 1069 DKEILDTCCEGISECIVKLLMEYASNVQTPIGWKT 1103 >10_08_0912 - 21520088-21520426,21520534-21520674,21521235-21521294, 21521394-21521493,21521591-21521904,21522253-21522621, 21522993-21523104,21523627-21523787 Length = 531 Score = 28.7 bits (61), Expect = 4.7 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +2 Query: 8 VLQFQFYSS*KRKLRVSPTDRVLSTLSRHSCILKTKVLQTMFSAPTMDVYKRNF 169 ++ F SS K L+ +S R +LKTK+ FS+ T+D++ F Sbjct: 155 IISSAFCSSKKLPLQPFQIMTSVSESGRSKSMLKTKIKHESFSSETLDIHPATF 208 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,195,400 Number of Sequences: 37544 Number of extensions: 374645 Number of successful extensions: 680 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 680 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1792053856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -