BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0393 (470 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic pr... 23 1.1 AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory recept... 21 4.3 AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory recept... 21 7.6 >U63132-1|AAB38392.1| 372|Tribolium castaneum decapentaplegic protein protein. Length = 372 Score = 23.4 bits (48), Expect = 1.1 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +1 Query: 328 EKGGPLCLPQKLGHRLLYMTTLHRKFLLKNHQ 423 E GP C+P +LG + +LKN++ Sbjct: 331 EVPGPCCVPTQLGQMSMLYLGSDGSVILKNYK 362 >AM292336-1|CAL23148.2| 455|Tribolium castaneum gustatory receptor candidate 15 protein. Length = 455 Score = 21.4 bits (43), Expect = 4.3 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -1 Query: 422 WWFFSKNFLCNVVMY 378 W FF NFL N++ + Sbjct: 243 WLFFLANFLTNLLFW 257 >AM292326-1|CAL23138.2| 522|Tribolium castaneum gustatory receptor candidate 5 protein. Length = 522 Score = 20.6 bits (41), Expect = 7.6 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -3 Query: 297 LDPIGVSAKHLYILTCLQCQLSLEIVKFYRSD 202 ++P G S K +L L L + I YR+D Sbjct: 23 VEPTGFSPKGYSLLWILLFTLGVTISGVYRTD 54 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,209 Number of Sequences: 336 Number of extensions: 1957 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10931752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -