BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0393 (470 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0481 - 21304802-21304920,21305063-21305131,21306140-21306557 44 5e-05 10_08_0654 - 19616426-19616656,19617046-19617249,19617654-196178... 43 1e-04 06_01_1075 - 8770120-8770371,8770684-8770770,8770866-8770946,877... 27 7.6 >06_03_0481 - 21304802-21304920,21305063-21305131,21306140-21306557 Length = 201 Score = 44.4 bits (100), Expect = 5e-05 Identities = 15/33 (45%), Positives = 24/33 (72%) Frame = +3 Query: 210 DKILQFQDLTGIEDMSICRDVLQRHQWDLEVAI 308 DK++ FQ +TGI D S+C ++L H WDL++ + Sbjct: 7 DKVIYFQAVTGISDHSLCTEILAAHDWDLQLVV 39 >10_08_0654 - 19616426-19616656,19617046-19617249,19617654-19617824, 19619617-19620411 Length = 466 Score = 42.7 bits (96), Expect = 1e-04 Identities = 15/33 (45%), Positives = 23/33 (69%) Frame = +3 Query: 210 DKILQFQDLTGIEDMSICRDVLQRHQWDLEVAI 308 DK+ FQ +TGI D +C ++L H WDL++A+ Sbjct: 7 DKVSYFQAVTGISDHDLCTEILAAHNWDLQLAV 39 >06_01_1075 - 8770120-8770371,8770684-8770770,8770866-8770946, 8771043-8771177,8771363-8771584,8771676-8771756, 8771954-8772115,8772991-8773106,8774333-8774474, 8774592-8774687,8774987-8775125,8776297-8776376 Length = 530 Score = 27.1 bits (57), Expect = 7.6 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -1 Query: 350 KHRGPPFSNIQLFLNCYL 297 +HRGP +S I + +CYL Sbjct: 29 RHRGPDWSGIHCYQDCYL 46 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,635,986 Number of Sequences: 37544 Number of extensions: 189463 Number of successful extensions: 349 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 347 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 349 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 955200320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -