BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0393 (470 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 27 0.10 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 8.8 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 27.1 bits (57), Expect = 0.10 Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 2/35 (5%) Frame = +3 Query: 186 LGLTQDQTD--KILQFQDLTGIEDMSICRDVLQRH 284 L L+ QTD KIL F ++ I + S+ +VLQ H Sbjct: 242 LSLSALQTDGYKILYFHAMSSIAEFSVSTEVLQDH 276 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 20.6 bits (41), Expect = 8.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +1 Query: 325 LEKGGPLCLPQKLGHRLLYMTTLHRKFLLKNHQ 423 + KGG L P + L TL RK+++ Q Sbjct: 269 IAKGGKLACPPAIFIFDLTTDTLIRKYIIPKEQ 301 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,802 Number of Sequences: 438 Number of extensions: 2392 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12682287 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -