BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0392 (639 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 4.4 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 7.6 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 4.4 Identities = 7/23 (30%), Positives = 13/23 (56%) Frame = -1 Query: 309 EHFVQRQSCLNTFATTWGYMPLL 241 +H +QRQ N WG++ ++ Sbjct: 462 QHHIQRQDEFNAEDQDWGFVAMV 484 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 7.6 Identities = 12/58 (20%), Positives = 26/58 (44%) Frame = -3 Query: 301 CSTTIMLEHICYNLGLYATSSIGATSRPHTLQRSRVYPQEEISKNGISFILEYFVLYV 128 CS+ +M+ + + S I A ++P+T V E ++ + F + + + V Sbjct: 414 CSSEVMMLRMARKYDVQTDSIIFANNQPYTKDSYTVAGMGETIEDLLHFCRQMYAMKV 471 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,150 Number of Sequences: 438 Number of extensions: 3013 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 19193721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -