BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0391 (462 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) 91 4e-19 SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) 71 5e-13 SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) 69 2e-12 SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) 68 4e-12 SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 6e-12 SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) 66 2e-11 SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 2e-10 SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_31961| Best HMM Match : EGF (HMM E-Value=0) 61 5e-10 SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) 60 9e-10 SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 58 4e-09 SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) 58 5e-09 SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 5e-09 SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) 57 6e-09 SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) 57 6e-09 SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) 56 1e-08 SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) 56 2e-08 SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 3e-08 SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 6e-08 SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) 51 4e-07 SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) 46 1e-05 SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) 42 2e-04 SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 4e-04 SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.022 SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) 36 0.022 SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.028 SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) 34 0.066 SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.27 SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) 32 0.27 SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_40474| Best HMM Match : IF3_C (HMM E-Value=7.7) 31 0.61 SB_51371| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_59668| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.5 SB_55091| Best HMM Match : DUF1502 (HMM E-Value=1.8) 28 3.3 SB_24812| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_34739| Best HMM Match : DUF360 (HMM E-Value=0.39) 28 4.3 SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) 28 4.3 SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012) 28 4.3 SB_184| Best HMM Match : PAN (HMM E-Value=4.1e-09) 27 5.7 SB_26611| Best HMM Match : tRNA_SAD (HMM E-Value=2.8) 27 5.7 SB_49628| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) 27 7.6 SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) 27 7.6 SB_41113| Best HMM Match : VWA (HMM E-Value=1.8e-21) 27 10.0 SB_10426| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_2428| Best HMM Match : ShTK (HMM E-Value=4.2e-21) 27 10.0 SB_40872| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 SB_33097| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 10.0 >SB_47290| Best HMM Match : Ank (HMM E-Value=5.4e-29) Length = 445 Score = 91.1 bits (216), Expect = 4e-19 Identities = 39/98 (39%), Positives = 62/98 (63%), Gaps = 1/98 (1%) Frame = +3 Query: 51 DDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKR 230 +D+Y+LL C E +T EQI E+K A + HPDK + ++ F +LK+A+++LCD R Sbjct: 287 EDFYSLLDCGEYATNEQINTEFKKKAKEWHPDKKRNDTDSHEYFARLKKARDVLCDEKMR 346 Query: 231 ALYDKWRRSGIAMGFKQWLGMKDHVQQSMHWS-KPNTK 341 A YD WR IA+ F+ W+ ++ S+HW+ KP ++ Sbjct: 347 AKYDHWRHIQIAVPFEVWMSLEKAAHASVHWAPKPRSQ 384 >SB_43852| Best HMM Match : DnaJ (HMM E-Value=1.7e-37) Length = 399 Score = 70.9 bits (166), Expect = 5e-13 Identities = 32/73 (43%), Positives = 49/73 (67%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRA 233 DYY +LG ++T I EY+ L+L++HPDKN E AE+KF++ EA ++L DP KRA Sbjct: 4 DYYDILGLTRSATDADIKKEYRKLSLKYHPDKNQ-EPSAEVKFRQAAEAYDVLSDPKKRA 62 Query: 234 LYDKWRRSGIAMG 272 +Y+++ G+ G Sbjct: 63 IYNQFGEEGLKSG 75 >SB_3383| Best HMM Match : DnaJ (HMM E-Value=3.8e-40) Length = 250 Score = 68.9 bits (161), Expect = 2e-12 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%) Frame = +3 Query: 51 DDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKE-AEMKFQKLKEAKEILCDPSK 227 +DYY +LG +++ E + Y+ AL+ HPDKN +E AE KF+KL EA E+L D K Sbjct: 3 EDYYEVLGVPRSASEEDVKKAYRRQALRWHPDKNPTNREHAEEKFKKLSEAYEVLSDKEK 62 Query: 228 RALYDKWRRSGI 263 R +YDK+ + G+ Sbjct: 63 RDIYDKYGKEGL 74 >SB_20922| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 576 Score = 67.7 bits (158), Expect = 4e-12 Identities = 30/70 (42%), Positives = 49/70 (70%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRA 233 DYY +LG N++ +QI ++ +A+++HPDKN G K+AE KF+++ EA E+L D +KR Sbjct: 26 DYYQILGVPRNASDKQIKKAFRKMAVKYHPDKNKG-KDAEEKFREVAEAYEVLSDENKRR 84 Query: 234 LYDKWRRSGI 263 YD++ G+ Sbjct: 85 QYDQFGEEGL 94 >SB_41006| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 725 Score = 67.3 bits (157), Expect = 6e-12 Identities = 29/66 (43%), Positives = 45/66 (68%) Frame = +3 Query: 48 DDDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSK 227 + +YY +LG + N+T + I Y+ LAL++HPDKN G +E F+++ EA E+LCDP + Sbjct: 2 ESNYYEVLGVERNATTDDIRRAYRRLALKYHPDKNAGTEE---NFKEVSEAYEVLCDPQQ 58 Query: 228 RALYDK 245 R +DK Sbjct: 59 RERFDK 64 >SB_21966| Best HMM Match : DnaJ (HMM E-Value=5.30001e-40) Length = 351 Score = 65.7 bits (153), Expect = 2e-11 Identities = 29/70 (41%), Positives = 46/70 (65%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRA 233 DYYA+L D+ ++ + I Y+ AL++HPDKN AE KF+++ EA E+L DP K+ Sbjct: 4 DYYAVLNVDKAASADDIKKAYRKQALKYHPDKNK-SPGAEEKFKEISEAYEVLSDPKKKE 62 Query: 234 LYDKWRRSGI 263 +YD++ G+ Sbjct: 63 IYDQYGEEGL 72 >SB_21411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 62.1 bits (144), Expect = 2e-10 Identities = 31/65 (47%), Positives = 39/65 (60%), Gaps = 2/65 (3%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKNDGE--KEAEMKFQKLKEAKEILCDPSK 227 DYY +LG N +IT Y+ LA++ HPD GE K+AE F + AKE+L DP K Sbjct: 208 DYYKILGLKRNCNKREITKAYRKLAVKWHPDNYKGEDKKKAEKMFIDIAAAKEVLTDPEK 267 Query: 228 RALYD 242 RA YD Sbjct: 268 RAKYD 272 >SB_39063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 350 Score = 61.7 bits (143), Expect = 3e-10 Identities = 27/73 (36%), Positives = 48/73 (65%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRA 233 +YY +LG ++++ +++ YK A ++HPDKN + AE KF+++ EA E+L DP KR Sbjct: 4 NYYDILGVKKDASDQELKKAYKKQAFKYHPDKNK-DPGAEEKFKEIAEAYEVLSDPQKRE 62 Query: 234 LYDKWRRSGIAMG 272 ++D++ G+ G Sbjct: 63 IFDQYGEEGLKGG 75 >SB_31961| Best HMM Match : EGF (HMM E-Value=0) Length = 2813 Score = 60.9 bits (141), Expect = 5e-10 Identities = 30/81 (37%), Positives = 47/81 (58%) Frame = +3 Query: 21 EILNYQRNPDDDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEA 200 E+ + D++Y +LG + +T +I Y+ ++LQ HPD+N E +AE+KF+KL Sbjct: 2472 ELFDIVEEVKDNFYQVLGVETTATQAEIRRAYRRISLQLHPDRNK-EDDAELKFRKLVAV 2530 Query: 201 KEILCDPSKRALYDKWRRSGI 263 E+L D KR YD R G+ Sbjct: 2531 AEVLKDEDKRKRYDTILRDGM 2551 >SB_293| Best HMM Match : DnaJ (HMM E-Value=7.6e-37) Length = 238 Score = 60.1 bits (139), Expect = 9e-10 Identities = 26/70 (37%), Positives = 43/70 (61%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRA 233 D+YA+LG +++ QI Y+ LA++ HPDKN + +A+ KF + A E+L D +R Sbjct: 25 DFYAILGVPRDASKNQIKRAYRKLAMKLHPDKNKDDPKAQEKFHDIGAAYEVLADDDQRK 84 Query: 234 LYDKWRRSGI 263 +YD+ G+ Sbjct: 85 IYDQRGEEGL 94 >SB_34890| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 386 Score = 58.0 bits (134), Expect = 4e-09 Identities = 33/84 (39%), Positives = 44/84 (52%) Frame = +3 Query: 48 DDDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSK 227 D Y LLG +N++ I Y+ LA + HPDKN E KF+ + A EIL DP K Sbjct: 3 DTRLYDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGE---KFKDITFAYEILSDPEK 59 Query: 228 RALYDKWRRSGIAMGFKQWLGMKD 299 R LYD++ G+ G G +D Sbjct: 60 RELYDRYGEKGLREGAGGGAGFED 83 >SB_31923| Best HMM Match : DnaJ (HMM E-Value=2.8e-38) Length = 161 Score = 57.6 bits (133), Expect = 5e-09 Identities = 27/70 (38%), Positives = 43/70 (61%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRA 233 +YYA+LG N++ + I Y+ AL HPDKN AE KF+++ EA ++L DP +R Sbjct: 4 NYYAILGVPRNASDDDIKKAYRRQALIFHPDKNK-NSGAEEKFKEISEAYKVLTDPRQRD 62 Query: 234 LYDKWRRSGI 263 ++D + G+ Sbjct: 63 IFDMYGEEGL 72 >SB_21898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1084 Score = 57.6 bits (133), Expect = 5e-09 Identities = 28/65 (43%), Positives = 39/65 (60%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRA 233 DYY +LG N+ ++I Y LA ++HPD N +K A KFQ++ EA E+L D KR Sbjct: 59 DYYKILGVPPNANQKEIKKAYFELAKKYHPDTNK-DKSASEKFQEVSEAYEVLSDDGKRK 117 Query: 234 LYDKW 248 YD + Sbjct: 118 AYDSF 122 >SB_59454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 285 Score = 57.2 bits (132), Expect = 6e-09 Identities = 28/77 (36%), Positives = 46/77 (59%), Gaps = 5/77 (6%) Frame = +3 Query: 27 LNYQRNPDDDYYALLGCDENSTVEQITAEYKILALQHHPDKNDG-----EKEAEMKFQKL 191 L +++ DYY +L + ++ ++I YK AL+HHPD++ G +K AE +F+++ Sbjct: 150 LELKKSKRKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEV 209 Query: 192 KEAKEILCDPSKRALYD 242 EA IL DP K+ YD Sbjct: 210 NEAYSILSDPKKKRRYD 226 >SB_42340| Best HMM Match : DnaJ (HMM E-Value=3.2e-32) Length = 264 Score = 57.2 bits (132), Expect = 6e-09 Identities = 28/77 (36%), Positives = 46/77 (59%), Gaps = 5/77 (6%) Frame = +3 Query: 27 LNYQRNPDDDYYALLGCDENSTVEQITAEYKILALQHHPDKNDG-----EKEAEMKFQKL 191 L +++ DYY +L + ++ ++I YK AL+HHPD++ G +K AE +F+++ Sbjct: 150 LELKKSKRKDYYKILNISKTASEDEIKKAYKKEALKHHPDRHSGASDEQKKIAEKQFKEV 209 Query: 192 KEAKEILCDPSKRALYD 242 EA IL DP K+ YD Sbjct: 210 NEAYSILSDPKKKRRYD 226 >SB_16146| Best HMM Match : DnaJ (HMM E-Value=2.7e-37) Length = 79 Score = 56.4 bits (130), Expect = 1e-08 Identities = 31/75 (41%), Positives = 41/75 (54%) Frame = +3 Query: 48 DDDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSK 227 D Y LLG +N++ I Y+ LA + HPDKN E KF+ + A EIL DP K Sbjct: 3 DTRLYDLLGVPQNASDNDIKKAYRKLAKELHPDKNPDTGE---KFKDITFAYEILSDPEK 59 Query: 228 RALYDKWRRSGIAMG 272 R LYD++ G+ G Sbjct: 60 RELYDRYGEKGLREG 74 >SB_37512| Best HMM Match : DnaJ (HMM E-Value=1.3e-29) Length = 291 Score = 55.6 bits (128), Expect = 2e-08 Identities = 26/64 (40%), Positives = 39/64 (60%) Frame = +3 Query: 51 DDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKR 230 ++YY LG ++ST ++I Y+ AL+ HPDKN +A F KL +A E+L DP R Sbjct: 6 ENYYDTLGVHKDSTEKEILKAYRKKALKCHPDKNPDNPKASELFHKLSKALEVLTDPKAR 65 Query: 231 ALYD 242 A ++ Sbjct: 66 AAFN 69 >SB_2261| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 54.8 bits (126), Expect = 3e-08 Identities = 25/66 (37%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = +3 Query: 57 YYALLGCDENSTVEQITAEYKILALQHHPDKN-DGEKEAEMKFQKLKEAKEILCDPSKRA 233 +Y +LG + + + Y+ LAL+ HPDKN D +E+ F+++++A ++L DP +RA Sbjct: 5 HYEVLGVERDVDDSALKKTYRKLALKWHPDKNLDNAEESTRVFREIQQAYDVLSDPQERA 64 Query: 234 LYDKWR 251 YDK R Sbjct: 65 FYDKHR 70 >SB_49296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 966 Score = 54.0 bits (124), Expect = 6e-08 Identities = 26/72 (36%), Positives = 41/72 (56%) Frame = +3 Query: 57 YYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRAL 236 YY +L +T +I Y+ LAL++HPDKN E + +F+++ +A E+L D KR + Sbjct: 66 YYDILNVPPTATATEIKKSYRKLALKYHPDKNPDEGD---RFKQISQAYEVLSDEKKRKI 122 Query: 237 YDKWRRSGIAMG 272 YD+ I G Sbjct: 123 YDEGGEDAIKGG 134 >SB_2842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 257 Score = 52.0 bits (119), Expect = 2e-07 Identities = 28/64 (43%), Positives = 41/64 (64%), Gaps = 2/64 (3%) Frame = +3 Query: 60 YALLGCDENSTVEQITAEYKILALQHHPDKND-GEKE-AEMKFQKLKEAKEILCDPSKRA 233 Y +LG + ++ +I Y+ ++LQ HPD+ D GEKE A KFQ L ++ IL D KRA Sbjct: 17 YDVLGVSKTASESEIKRAYRKISLQVHPDRADKGEKEKATRKFQALSKSYCILSDKEKRA 76 Query: 234 LYDK 245 +YD+ Sbjct: 77 IYDE 80 >SB_16477| Best HMM Match : DnaJ (HMM E-Value=8.1e-33) Length = 138 Score = 51.2 bits (117), Expect = 4e-07 Identities = 24/56 (42%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKN-DGEKEAEMKFQKLKEAKEILCD 218 DYY +L +++ + I Y+ LAL+ HPDKN ++EAE KF+++ EA E+L D Sbjct: 3 DYYDILEVPRSASEQDIKKSYRKLALKWHPDKNPQNKEEAERKFKEISEAYEVLSD 58 >SB_6887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 875 Score = 49.6 bits (113), Expect = 1e-06 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 2/60 (3%) Frame = +3 Query: 60 YALLGCDENSTVEQITAEYKILALQHHPDKN-DGEKEAEMKFQKLKEAKEILCD-PSKRA 233 Y +LG E++T E+I YK LA++ HPD++ D ++EA+ F +++EA EIL +KRA Sbjct: 796 YRVLGLTEDATQEEIKKRYKKLAMKWHPDRHRDNKEEAQKHFMEIQEAYEILSKLKTKRA 855 >SB_34242| Best HMM Match : DnaJ (HMM E-Value=9.2e-30) Length = 238 Score = 46.4 bits (105), Expect = 1e-05 Identities = 20/64 (31%), Positives = 36/64 (56%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRA 233 +YY +LG ++ +I Y L+++HHPD++ G + FQ++ EA +L + R Sbjct: 72 NYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKKHEVFQEIAEAYSVLGNLESRK 131 Query: 234 LYDK 245 YD+ Sbjct: 132 QYDR 135 >SB_11933| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 46.4 bits (105), Expect = 1e-05 Identities = 20/64 (31%), Positives = 36/64 (56%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRA 233 +YY +LG ++ +I Y L+++HHPD++ G + FQ++ EA +L + R Sbjct: 72 NYYNVLGVSPKASQSKIKDAYYKLSMKHHPDRHQGSDKKHEVFQEIAEAYSVLGNLESRK 131 Query: 234 LYDK 245 YD+ Sbjct: 132 QYDR 135 >SB_56859| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1671 Score = 41.9 bits (94), Expect = 2e-04 Identities = 23/73 (31%), Positives = 42/73 (57%), Gaps = 1/73 (1%) Frame = +3 Query: 12 GVDEILNYQRN-PDDDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQK 188 G +I + R+ + D YA+L D ++V +I +Y+ L+ ++HPDK G+ KF + Sbjct: 1233 GAYKISQFDRDFAEYDPYAVLEIDRGASVAEIRRQYRSLSKKYHPDKETGDPR---KFMR 1289 Query: 189 LKEAKEILCDPSK 227 + +A E + D +K Sbjct: 1290 IAKAYEAVSDFNK 1302 >SB_48086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1353 Score = 34.7 bits (76), Expect(2) = 4e-04 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 1/39 (2%) Frame = +3 Query: 54 DYYALLGCDENSTVEQITAEYKILALQHHPDKN-DGEKE 167 DYYA+L + + +++ A Y+ L + +HPDK+ D EK+ Sbjct: 131 DYYAVLAVRKEANEDELKAAYRRLCVLYHPDKHTDPEKK 169 Score = 25.8 bits (54), Expect(2) = 4e-04 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +3 Query: 180 FQKLKEAKEILCDPSKRALY 239 F K+++A E+L DP +A+Y Sbjct: 202 FSKVQKAYEVLSDPETKAIY 221 >SB_56064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 711 Score = 39.9 bits (89), Expect = 0.001 Identities = 21/47 (44%), Positives = 28/47 (59%) Frame = +3 Query: 51 DDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKL 191 +DYY L G ++T ++I +K LAL+ HPDKN K MK KL Sbjct: 27 EDYYELFGISRDATSKEIRKAFKKLALRLHPDKN---KVCMMKILKL 70 >SB_58160| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 35.5 bits (78), Expect = 0.022 Identities = 18/80 (22%), Positives = 37/80 (46%) Frame = +3 Query: 39 RNPDDDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCD 218 R ++Y +L ++++ +I + + + HPD N + ++ F K+ EA L Sbjct: 3 RQKKKNFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSS 62 Query: 219 PSKRALYDKWRRSGIAMGFK 278 ++R YD S A ++ Sbjct: 63 SARRQQYDARLNSSFASTYR 82 >SB_45438| Best HMM Match : DnaJ (HMM E-Value=4.4e-26) Length = 211 Score = 35.5 bits (78), Expect = 0.022 Identities = 18/80 (22%), Positives = 37/80 (46%) Frame = +3 Query: 39 RNPDDDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCD 218 R ++Y +L ++++ +I + + + HPD N + ++ F K+ EA L Sbjct: 64 RQKKKNFYEILDVPKDASQTEIKSAFIKKTKEFHPDVNPDDPDSHKAFIKVSEAYTTLSS 123 Query: 219 PSKRALYDKWRRSGIAMGFK 278 ++R YD S A ++ Sbjct: 124 SARRQQYDARLNSSFASTYR 143 >SB_24444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 35.1 bits (77), Expect = 0.028 Identities = 23/75 (30%), Positives = 36/75 (48%), Gaps = 2/75 (2%) Frame = +3 Query: 21 EILNYQRNPDDDYYALLGCDENSTVEQITAEYKILALQHHPDKN--DGEKEAEMKFQKLK 194 E++ +N D +Y LG + +T + I YK LA+ HPDK+ G +EA L Sbjct: 133 EVIQRLKNAKD-HYERLGIQQGATKDDINRAYKKLAVLIHPDKSVAPGSEEAFKALSSLN 191 Query: 195 EAKEILCDPSKRALY 239 + PS ++ Y Sbjct: 192 YGQMATGYPSIQSRY 206 >SB_17567| Best HMM Match : DnaJ (HMM E-Value=0.0007) Length = 831 Score = 33.9 bits (74), Expect = 0.066 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = +3 Query: 9 TGVDEILNYQRNPDDDYYALLGCDENSTVEQITAEYKILALQHHPDK 149 TG D IL D Y++LG ++ + I +Y+ LA+ HPDK Sbjct: 785 TGNDAILQMLSRRHGDPYSILGVPPEASDDDIKRQYRKLAVLIHPDK 831 >SB_2302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 445 Score = 31.9 bits (69), Expect = 0.27 Identities = 21/70 (30%), Positives = 33/70 (47%) Frame = +3 Query: 36 QRNPDDDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILC 215 +RN ++Y ++ +T +I + Y L+ +HPD N EA +F +L A L Sbjct: 45 RRNNPKNHYDVMKLLPTATQREIKSAYYELSRIYHPDLN-SSAEARERFAELTLAYNTLS 103 Query: 216 DPSKRALYDK 245 R YDK Sbjct: 104 RLETRREYDK 113 >SB_13439| Best HMM Match : DnaJ (HMM E-Value=5.9e-24) Length = 565 Score = 31.9 bits (69), Expect = 0.27 Identities = 21/70 (30%), Positives = 33/70 (47%) Frame = +3 Query: 36 QRNPDDDYYALLGCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILC 215 +RN ++Y ++ +T +I + Y L+ +HPD N EA +F +L A L Sbjct: 192 RRNNPKNHYDVMKLLPTATQREIKSAYYELSRIYHPDLN-SSAEARERFAELTLAYNTLS 250 Query: 216 DPSKRALYDK 245 R YDK Sbjct: 251 RLETRREYDK 260 >SB_5461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1766 Score = 31.1 bits (67), Expect = 0.46 Identities = 22/86 (25%), Positives = 36/86 (41%), Gaps = 2/86 (2%) Frame = -1 Query: 264 LYHYDATCHTEHAWMDHTESPWL-PLTSETSFQLLFHHRFCQGGVAGQVSYILQLFAPQL 88 LY + T+ ++D + W P TSE S L + VS +P+ Sbjct: 1476 LYAHGYDRPTDLNFLDAIQHNWSSPQTSEDSLWLALERGVSTDAIEPDVSDYQYSLSPEH 1535 Query: 87 SFHHNPVGRSSH-HLGFFDNSIFRPR 13 ++ H+PV +H H G + + R R Sbjct: 1536 TYKHSPVDIRAHGHQGLYSENHVRER 1561 >SB_40474| Best HMM Match : IF3_C (HMM E-Value=7.7) Length = 146 Score = 30.7 bits (66), Expect = 0.61 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = -3 Query: 457 PQRPQRAAPPSEARRVAGLLGPRLDGPYGLLPSPSNMRSLVLGL 326 PQ+PQ A+P E R+ AG+ + D P PS S + GL Sbjct: 60 PQKPQEASPLDEKRKRAGITPIKFDIPPEKKPSVSPQHAKRSGL 103 >SB_51371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1325 Score = 30.7 bits (66), Expect = 0.61 Identities = 17/44 (38%), Positives = 23/44 (52%) Frame = -3 Query: 457 PQRPQRAAPPSEARRVAGLLGPRLDGPYGLLPSPSNMRSLVLGL 326 PQ+PQ A+P E R+ AG+ + D P PS S + GL Sbjct: 457 PQKPQEASPLDEKRKRAGITPIKFDIPPEKKPSVSPQHAKRSGL 500 >SB_59668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 623 Score = 28.7 bits (61), Expect = 2.5 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = -3 Query: 391 RLDGPYGLLPSPSNMRSLVLGLDQCMDCCT*SFIPNHCLKPIAIPLRRHLSY 236 R YGL+P P+ R++V L C S I N+ L I I L RH Y Sbjct: 361 RFCSAYGLVPIPAQHRTIVRFLIHLSTYCKYSTIANY-LSAINI-LHRHFGY 410 >SB_55091| Best HMM Match : DUF1502 (HMM E-Value=1.8) Length = 315 Score = 28.3 bits (60), Expect = 3.3 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 243 CHTEHAWMD-HTESPWLPLTSETSFQLLFHHR-FCQGGVA 130 CH HAW + TE P + F+ R CQGG A Sbjct: 95 CHNNHAWAELPTEPPAIASVHGLDFEAEREFRSLCQGGAA 134 >SB_24812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1384 Score = 27.9 bits (59), Expect = 4.3 Identities = 26/78 (33%), Positives = 35/78 (44%), Gaps = 5/78 (6%) Frame = +3 Query: 18 DEILNYQRNPDDDYYALLGCDENSTVEQITAEYKILALQHH-PDKNDGEKEAEMKFQ--- 185 DEI Q+ +D L + + A+ K L+ + D ND KE E K Q Sbjct: 778 DEIARLQK-ATNDLKEELEAQGKAKYDLEAAKEKTKKLESNLKDNNDKIKELEKKLQDVT 836 Query: 186 -KLKEAKEILCDPSKRAL 236 KLK+A+ D KRAL Sbjct: 837 GKLKDAESKASDEEKRAL 854 >SB_34739| Best HMM Match : DUF360 (HMM E-Value=0.39) Length = 1024 Score = 27.9 bits (59), Expect = 4.3 Identities = 19/47 (40%), Positives = 24/47 (51%) Frame = -3 Query: 376 YGLLPSPSNMRSLVLGLDQCMDCCT*SFIPNHCLKPIAIPLRRHLSY 236 YGL+P P+ R++V L C S I N+ L I I L RH Y Sbjct: 767 YGLVPIPAQHRTIVRFLIHLSTYCKYSNITNY-LSAINI-LHRHFGY 811 >SB_33591| Best HMM Match : DnaJ (HMM E-Value=0.0056) Length = 219 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = +3 Query: 147 KNDGEKEAEMKFQKLKEAKEILCDPSKRALYD 242 K D ++ A KFQ + A E L DP +R YD Sbjct: 72 KGDDKENAIKKFQLIATAYETLKDPEQRNDYD 103 >SB_33497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = -3 Query: 454 QRPQRAAPPSEARRVAGLLGPRLDGPYGLLPSPSN 350 ++ R P ARR A GP ++ P G SPSN Sbjct: 673 KKGSRVNSPIGARRRANSPGPSINSPRGRAESPSN 707 >SB_4695| Best HMM Match : SAM_1 (HMM E-Value=0.012) Length = 1348 Score = 27.9 bits (59), Expect = 4.3 Identities = 16/61 (26%), Positives = 30/61 (49%) Frame = +3 Query: 102 ITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRALYDKWRRSGIAMGFKQ 281 IT + K L ++ KE+E F++ + A ++ C +K++ YD + A K+ Sbjct: 992 ITPKLKSLIASRQAALHNSGKESEA-FKQYRNAVQLECSVAKKSYYDNKVAALKATNIKR 1050 Query: 282 W 284 W Sbjct: 1051 W 1051 >SB_184| Best HMM Match : PAN (HMM E-Value=4.1e-09) Length = 720 Score = 27.5 bits (58), Expect = 5.7 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +3 Query: 246 WRRSGIAMGFKQWLGMKDHVQQSMHWSKPN 335 W R A+ K +GM DHV +W +PN Sbjct: 500 WSRDHPALSCKAIIGM-DHVTDGYYWIQPN 528 >SB_26611| Best HMM Match : tRNA_SAD (HMM E-Value=2.8) Length = 125 Score = 27.5 bits (58), Expect = 5.7 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 3/77 (3%) Frame = +3 Query: 96 EQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEA-KEI--LCDPSKRALYDKWRRSGIA 266 E + AE AL+ +K E EAE K ++KEA +EI L + A+ W++ + Sbjct: 34 EGLKAEKHCEALEARVEKIRKEVEAESKNLRVKEAGQEITRLIEDINAAVISAWKKEEMR 93 Query: 267 MGFKQWLGMKDHVQQSM 317 K+ + D+ ++M Sbjct: 94 QTLKKVKKIVDNASKAM 110 >SB_49628| Best HMM Match : CBM_5_12 (HMM E-Value=8.9) Length = 312 Score = 27.1 bits (57), Expect = 7.6 Identities = 15/40 (37%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = -1 Query: 243 CHTEHAWMD-HTESPWLPLTSETSFQLLFHHR-FCQGGVA 130 CH HAW + TE P + F+ R FCQG A Sbjct: 166 CHNNHAWAELPTEPPAIASVHGLDFEAESELRSFCQGEAA 205 >SB_16586| Best HMM Match : DnaJ (HMM E-Value=4.9e-10) Length = 141 Score = 27.1 bits (57), Expect = 7.6 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 8/67 (11%) Frame = +3 Query: 36 QRNPD-DDYYALLGCDENSTVEQITAEYKILALQHHPDK-------NDGEKEAEMKFQKL 191 QR P +D +LG I Y+ L +HHPDK + + A+ K Q++ Sbjct: 68 QRGPTLEDACNVLGVKPTDDATTIKRAYRKLMSEHHPDKLVAKGLPPEMMEMAKQKAQEI 127 Query: 192 KEAKEIL 212 ++A E++ Sbjct: 128 QQAYELI 134 >SB_41113| Best HMM Match : VWA (HMM E-Value=1.8e-21) Length = 240 Score = 26.6 bits (56), Expect = 10.0 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 9 TGVDEILNYQRNPDDDYYALLGCDENSTVEQITAE 113 T E+ N+ +NP D ++ D ST E +TAE Sbjct: 95 TSFYEMFNFTKNPGDQNILIVLVDGPSTDEVLTAE 129 >SB_10426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 318 Score = 26.6 bits (56), Expect = 10.0 Identities = 18/58 (31%), Positives = 31/58 (53%) Frame = +3 Query: 90 TVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEILCDPSKRALYDKWRRSGI 263 T +Q+TA K+ + H+PD E+ A L+EA+ + ++RA Y K +R + Sbjct: 75 THQQLTALEKVFSKTHYPDVEVREQLATS--TNLQEARIQVWFKNRRAKYRKDQRRSL 130 >SB_2428| Best HMM Match : ShTK (HMM E-Value=4.2e-21) Length = 388 Score = 26.6 bits (56), Expect = 10.0 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +3 Query: 72 GCDENSTVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEIL 212 G D N IT K+L ++ D NDG Q + +A ++L Sbjct: 91 GYDGNDRGSVITQANKVLVIEDDDDGNDGGPSDHSDKQVITQANKVL 137 >SB_40872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 26.6 bits (56), Expect = 10.0 Identities = 16/41 (39%), Positives = 21/41 (51%) Frame = +3 Query: 87 STVEQITAEYKILALQHHPDKNDGEKEAEMKFQKLKEAKEI 209 STVE I +Y + +Q HP+KN E KEA +I Sbjct: 68 STVEGI--KYPVYGVQWHPEKNQFEWSRREDIPHSKEAIQI 106 >SB_33097| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 26.6 bits (56), Expect = 10.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 81 HHNPVGRSSHHLGFFDNSIFRPR 13 H V +S HLGFFD+ F PR Sbjct: 55 HWLGVYETSDHLGFFDSFDFNPR 77 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,748,902 Number of Sequences: 59808 Number of extensions: 297503 Number of successful extensions: 948 Number of sequences better than 10.0: 52 Number of HSP's better than 10.0 without gapping: 866 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 931 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 945255773 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -