BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0389 (564 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0087 + 14476539-14476675,14478876-14479635,14479720-144798... 29 2.6 03_05_0754 + 27452203-27452242,27452360-27455611,27456480-274565... 29 3.4 05_05_0077 + 22226326-22226441,22226527-22226601,22227619-222277... 28 4.5 07_01_0226 - 1654917-1656923,1658757-1658810,1659128-1660891 28 5.9 03_06_0311 + 33054022-33054118,33056109-33056353,33057058-330573... 28 5.9 05_05_0348 + 24271764-24271898,24273055-24273144,24273205-242733... 27 7.8 04_04_1249 - 32067644-32067787,32068245-32068346,32068415-320684... 27 7.8 02_04_0481 + 23284296-23284448,23284553-23284753,23284855-232879... 27 7.8 >09_04_0087 + 14476539-14476675,14478876-14479635,14479720-14479871, 14479958-14480024,14480632-14480831,14480915-14481068, 14481585-14481669,14481766-14481857,14482575-14482766, 14482867-14482992,14483072-14483125,14483494-14483550, 14484509-14484606,14484703-14485038,14485116-14485203, 14486891-14487016,14487082-14487138,14488054-14488133, 14488228-14488270,14488948-14489034,14489331-14489420, 14489996-14490054,14490141-14490231,14490330-14490495, 14490662-14490755,14491787-14492909 Length = 1537 Score = 29.1 bits (62), Expect = 2.6 Identities = 19/48 (39%), Positives = 22/48 (45%), Gaps = 2/48 (4%) Frame = +1 Query: 406 KDNAKFKED--ARLEREKLKTKLDSENPQDANMSEPSNKAESSEEKLK 543 KDN K KE E+EK K K D + E +K E EEK K Sbjct: 232 KDNEKEKEQLMGTDEKEKEKEKEDENEEEKLEEEEKKDKEEKLEEKEK 279 >03_05_0754 + 27452203-27452242,27452360-27455611,27456480-27456533, 27456774-27456872,27456948-27457012,27457476-27457575, 27458326-27458408,27458494-27458569,27458920-27459698 Length = 1515 Score = 28.7 bits (61), Expect = 3.4 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = +1 Query: 427 EDARLEREKLKTKLDSENPQDANMSEPSNKAESSEEKLKALYGK 558 E ERE+++ +LD+ N +A+ K ESSEE+ K L+ K Sbjct: 518 EHMEKEREEMQRQLDTYNLDNASRDVHCLKGESSEEE-KGLHEK 560 >05_05_0077 + 22226326-22226441,22226527-22226601,22227619-22227781, 22227867-22228166 Length = 217 Score = 28.3 bits (60), Expect = 4.5 Identities = 16/50 (32%), Positives = 27/50 (54%) Frame = +1 Query: 394 IQFLKDNAKFKEDARLEREKLKTKLDSENPQDANMSEPSNKAESSEEKLK 543 + L D A+ R E +KLK+ +E+ QD+ S + K+E +EK + Sbjct: 83 VSILSDAARLLSQLRAEAQKLKS--SNESLQDSIKSLKAEKSELRDEKTR 130 >07_01_0226 - 1654917-1656923,1658757-1658810,1659128-1660891 Length = 1274 Score = 27.9 bits (59), Expect = 5.9 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -2 Query: 542 FNFSSELSALLEGSDMFASWGFSESNL 462 F F S LSAL G D F GF+ +NL Sbjct: 609 FLFISNLSALATGEDQFIYSGFNGANL 635 >03_06_0311 + 33054022-33054118,33056109-33056353,33057058-33057398, 33057488-33057538,33057623-33057695,33058229-33058333, 33060124-33060206,33061209-33061249,33061659-33063120, 33063368-33064847,33064958-33065122,33065232-33065424, 33065502-33065613,33065702-33065849,33065951-33066148, 33066234-33066512,33066612-33066773,33066872-33067090, 33067481-33067612 Length = 1861 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +1 Query: 424 KEDARLEREKLKTKLDSENPQDANMSEPSNKAESSEEKLKA 546 KED +E E L+++ D + +EP N+ +S+ +A Sbjct: 356 KEDEPVENENLESEFDVSKKESNGATEPGNEPVASKRPKRA 396 >05_05_0348 + 24271764-24271898,24273055-24273144,24273205-24273303, 24273725-24273826,24273912-24274088,24274193-24274398, 24274491-24274575,24274641-24274798,24274873-24274948, 24275117-24275245,24275313-24275457,24275561-24275691, 24276183-24276335,24276447-24276636,24277006-24277139, 24277248-24277406,24277659-24277964,24278040-24278216, 24278446-24278529,24278592-24278822,24278913-24279002, 24279090-24279211,24279293-24279448,24279477-24279635, 24279705-24279765,24280004-24280138,24280384-24280471, 24280548-24280620,24280883-24280994,24281691-24281711 Length = 1327 Score = 27.5 bits (58), Expect = 7.8 Identities = 13/50 (26%), Positives = 27/50 (54%) Frame = +1 Query: 391 FIQFLKDNAKFKEDARLEREKLKTKLDSENPQDANMSEPSNKAESSEEKL 540 F +F + + K++ED + ++K+K KL+ + +D + + S K L Sbjct: 389 FKEFERKDVKYREDLKHLKQKIK-KLEDKTEKDTSKIDESTKEVEESSSL 437 >04_04_1249 - 32067644-32067787,32068245-32068346,32068415-32068438, 32068439-32068543,32068625-32068729,32068885-32068966, 32069254-32069456,32069534-32069692,32070045-32070154, 32070264-32070405,32070544-32070690,32070773-32070847, 32070923-32071132,32071223-32071426,32071514-32071633, 32071743-32071852,32072033-32072177,32072266-32072499, 32072611-32072646 Length = 818 Score = 27.5 bits (58), Expect = 7.8 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +1 Query: 427 EDARL-EREKLKTKLDSENPQDANMSEPSNKAESSEEKLKALY 552 ED L E+EKL++ +D+EN Q A + + S E+LKA + Sbjct: 114 EDGYLVEQEKLRSTMDAENAQHAKLEA---QLSSDLEELKAAH 153 >02_04_0481 + 23284296-23284448,23284553-23284753,23284855-23287971, 23288510-23289353,23289468-23290120,23290573-23290676, 23290898-23291000 Length = 1724 Score = 27.5 bits (58), Expect = 7.8 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +1 Query: 442 EREKLKTKLDSENPQDANMSEPSNKAESSEEKLK 543 E +KLK LD N + N+ N+ S +KLK Sbjct: 815 EVDKLKHALDENNSEIENLKHTLNEKNSETDKLK 848 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.309 0.124 0.349 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,712,962 Number of Sequences: 37544 Number of extensions: 163947 Number of successful extensions: 417 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 416 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1293275844 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 42 (21.8 bits)
- SilkBase 1999-2023 -