BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0375 (585 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27260.1 68416.m03407 DNA-binding bromodomain-containing prot... 36 0.020 At1g35660.1 68414.m04432 expressed protein 33 0.14 At5g20280.1 68418.m02414 sucrose-phosphate synthase, putative si... 30 0.99 At1g17900.1 68414.m02216 hypothetical protein 30 0.99 At1g80210.1 68414.m09387 expressed protein 30 1.3 At4g00920.1 68417.m00125 COP1-interacting protein-related simila... 29 1.7 At3g61380.1 68416.m06869 expressed protein 29 1.7 At3g45120.1 68416.m04870 hypothetical protein 29 1.7 At2g32460.1 68415.m03965 myb family transcription factor (MYB101... 29 1.7 At1g47260.1 68414.m05232 bacterial transferase hexapeptide repea... 29 1.7 At1g17780.2 68414.m02200 expressed protein 29 1.7 At1g17780.1 68414.m02201 expressed protein 29 1.7 At2g43650.1 68415.m05425 Sas10/U3 ribonucleoprotein (Utp) family... 29 2.3 At4g18250.1 68417.m02710 receptor serine/threonine kinase, putat... 29 3.0 At5g63980.1 68418.m08033 3'(2'),5'-bisphosphate nucleotidase / i... 28 4.0 At5g43590.1 68418.m05329 patatin, putative similar to patatin-li... 28 4.0 At5g07690.1 68418.m00882 myb family transcription factor (MYB29)... 28 4.0 At3g19020.1 68416.m02415 leucine-rich repeat family protein / ex... 28 4.0 At5g22650.2 68418.m02647 expressed protein non-consensus AT dono... 28 5.3 At5g22650.1 68418.m02646 expressed protein non-consensus AT dono... 28 5.3 At2g47850.1 68415.m05972 zinc finger (CCCH-type) family protein ... 28 5.3 At1g56080.1 68414.m06439 expressed protein 28 5.3 At5g44750.1 68418.m05485 UMUC-like DNA repair family protein / B... 27 7.0 At5g17370.1 68418.m02036 WD-40 repeat family protein contains 1 ... 27 7.0 At5g07980.1 68418.m00928 dentin sialophosphoprotein-related cont... 27 7.0 At5g02460.1 68418.m00173 Dof-type zinc finger domain-containing ... 27 7.0 At2g39170.1 68415.m04811 expressed protein 27 7.0 At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing ... 27 9.2 At4g31430.2 68417.m04465 expressed protein 27 9.2 At4g31430.1 68417.m04464 expressed protein 27 9.2 At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pf... 27 9.2 At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pf... 27 9.2 >At3g27260.1 68416.m03407 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 813 Score = 35.9 bits (79), Expect = 0.020 Identities = 36/138 (26%), Positives = 58/138 (42%), Gaps = 2/138 (1%) Frame = +1 Query: 124 SRVSTDAG--EDSADDLDESHTDDISRVTDIENETPSFSEDTFSKDDVFYNASSTSLGCA 297 S +D+G ED +DD D S++ + N E+T DD+F + ST G Sbjct: 444 SSSDSDSGSSEDQSDDAKPMVQGDSSKMPETANSEAQRDENT-RIDDLFVGSQST--GAL 500 Query: 298 PVIPTSSQYGLAIVGQDNANNQIGSSVPNSNNTEANDMHVSVTNASAGSIINLIGNAKPQ 477 + SQ L+ D + G+ + ++E + N A I+ PQ Sbjct: 501 EQMDICSQQKLSSDESDGQHE--GNILETPASSEKRYRAALLKNRFADIILKAREKPLPQ 558 Query: 478 EGMKEIQEHVRNERFKVV 531 G+K E +R ER ++V Sbjct: 559 NGIKGDPERLRKEREELV 576 >At1g35660.1 68414.m04432 expressed protein Length = 1155 Score = 33.1 bits (72), Expect = 0.14 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = +1 Query: 163 DLDESHTDDISRVTDIENETPSFSEDTFSKD 255 DL+E D ++ + D ENET +FSED F++D Sbjct: 410 DLEEEALDPVT-IADHENETVTFSEDKFTED 439 >At5g20280.1 68418.m02414 sucrose-phosphate synthase, putative similar to sucrose-phosphate synthase (EC 2.4.1.14) isoform 1 - Citrus unshiu, EMBL:AB005023 Length = 1043 Score = 30.3 bits (65), Expect = 0.99 Identities = 31/114 (27%), Positives = 47/114 (41%) Frame = +1 Query: 190 ISRVTDIENETPSFSEDTFSKDDVFYNASSTSLGCAPVIPTSSQYGLAIVGQDNANNQIG 369 +SR+T + P + D D+ + S SL I + ++ G DN NQ G Sbjct: 662 LSRITSFKPRHPQWQSDD-GGDNSEPESPSDSLRDIQDISLNLKFSFDGSGNDNYMNQEG 720 Query: 370 SSVPNSNNTEANDMHVSVTNASAGSIINLIGNAKPQEGMKEIQEHVRNERFKVV 531 SS+ + EA +V N S G +G+ + E VR +F VV Sbjct: 721 SSMDRKSKIEA-----AVQNWSKGKDSRKMGSLERSEVNSGKFPAVRRRKFIVV 769 >At1g17900.1 68414.m02216 hypothetical protein Length = 184 Score = 30.3 bits (65), Expect = 0.99 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 9/87 (10%) Frame = +1 Query: 79 LNYCVCEIITSVTLGSRVSTDAGEDSADD----LDESH--TDDISRVTD---IENETPSF 231 LN V I T TLG+ VS G+D+ D +DE++ D+ + D E+E Sbjct: 33 LNLFVSFITTVKTLGNNVSRTHGDDAESDRVSNVDENNEAVDEQDNIEDDKTDEDEKEGD 92 Query: 232 SEDTFSKDDVFYNASSTSLGCAPVIPT 312 +ED DD Y S+G + + PT Sbjct: 93 NEDGDGYDD--YQGDDESMGGSTLDPT 117 >At1g80210.1 68414.m09387 expressed protein Length = 354 Score = 29.9 bits (64), Expect = 1.3 Identities = 24/86 (27%), Positives = 34/86 (39%) Frame = +1 Query: 235 EDTFSKDDVFYNASSTSLGCAPVIPTSSQYGLAIVGQDNANNQIGSSVPNSNNTEANDMH 414 E +FS D Y SS++ G P + TS + G NNTEAN+ Sbjct: 150 ESSFSSSDSIYQRSSSARGDNPELDTSDTATTS--GSKGGGRVSDFEAFFVNNTEANNTR 207 Query: 415 VSVTNASAGSIINLIGNAKPQEGMKE 492 T+ + S I + E M+E Sbjct: 208 RDGTSGNYSSTAIEIDSMDMSESMQE 233 >At4g00920.1 68417.m00125 COP1-interacting protein-related similar to COP1-interacting protein 4 (CIP4) [Arabidopsis thaliana] GI:13160646 Length = 314 Score = 29.5 bits (63), Expect = 1.7 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 160 DDLDESHTDDISRVTDIENETPSFSEDTFSKDD 258 DD +ESH DD RV + N++ + +KDD Sbjct: 182 DDENESHKDDDVRVVEDINQSADVENEGINKDD 214 >At3g61380.1 68416.m06869 expressed protein Length = 718 Score = 29.5 bits (63), Expect = 1.7 Identities = 20/64 (31%), Positives = 28/64 (43%) Frame = +1 Query: 97 EIITSVTLGSRVSTDAGEDSADDLDESHTDDISRVTDIENETPSFSEDTFSKDDVFYNAS 276 EI+ + S + EDS D D T D+S D NET + D S+ D Sbjct: 372 EILQTPETSSATNDLIDEDSDKDDDTLFTIDVSVPRDYGNETENIDNDEESEIDPLSETC 431 Query: 277 STSL 288 S+S+ Sbjct: 432 SSSV 435 >At3g45120.1 68416.m04870 hypothetical protein Length = 106 Score = 29.5 bits (63), Expect = 1.7 Identities = 16/60 (26%), Positives = 27/60 (45%) Frame = +1 Query: 79 LNYCVCEIITSVTLGSRVSTDAGEDSADDLDESHTDDISRVTDIENETPSFSEDTFSKDD 258 LN V I T TLG+ VS G+D+ D ++ ++ +E +D +D+ Sbjct: 33 LNLFVSFITTVKTLGNNVSRTHGDDAESDCVCDSVSNVDENNEVVDEQDDVEDDKTDEDE 92 >At2g32460.1 68415.m03965 myb family transcription factor (MYB101) identical to putative transcription factor MYB101 GI:18087348 from [Arabidopsis thaliana] Length = 490 Score = 29.5 bits (63), Expect = 1.7 Identities = 29/92 (31%), Positives = 44/92 (47%), Gaps = 9/92 (9%) Frame = +1 Query: 163 DLDESHTDDISRVTDIENETPSFSEDTFSKDDVFYNAS-----STSLGCAPVIPTSSQ-- 321 DLD +H + I + T+ N + S S + S ST+ G P IP SS Sbjct: 157 DLDHNHQNMI-QYTNSSNTSSSSSSFSSSSSQPSKRLRPDPLVSTNPGLNP-IPDSSMDF 214 Query: 322 --YGLAIVGQDNANNQIGSSVPNSNNTEANDM 411 + L +N NNQ G SVP S+++ +N++ Sbjct: 215 QMFSLYNNSLENDNNQFGFSVPLSSSSSSNEV 246 >At1g47260.1 68414.m05232 bacterial transferase hexapeptide repeat-containing protein contains Pfam profile PF00132: Bacterial transferase hexapeptide (four repeats) Length = 278 Score = 29.5 bits (63), Expect = 1.7 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 1/80 (1%) Frame = +1 Query: 229 FSEDTFSKDDVFYNASSTSLGCAPVIPTSS-QYGLAIVGQDNANNQIGSSVPNSNNTEAN 405 F + DVF S++ +G + SS YG + G N N +GS +NT Sbjct: 49 FDKSPLVDKDVFVAPSASVIGDVQIGKGSSIWYGCVLRGDVN-NISVGSGTNIQDNTL-- 105 Query: 406 DMHVSVTNASAGSIINLIGN 465 +HV+ TN S + LIG+ Sbjct: 106 -VHVAKTNISGKVLPTLIGD 124 >At1g17780.2 68414.m02200 expressed protein Length = 263 Score = 29.5 bits (63), Expect = 1.7 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 1/86 (1%) Frame = +1 Query: 109 SVTLGSRVSTDAGEDSADDLDESHTDDISRVTDIENETP-SFSEDTFSKDDVFYNASSTS 285 SV + ++ + D SHTD +S + ++TP SF DD F + S S Sbjct: 55 SVLIDEKLEEYSDCDRTATTSRSHTDPVS--SQSTHQTPESFRTPITCDDDTFVSVSGIS 112 Query: 286 LGCAPVIPTSSQYGLAIVGQDNANNQ 363 + +IP +++ + V + AN + Sbjct: 113 RDVSNLIPFATETPASPVQEKMANTR 138 >At1g17780.1 68414.m02201 expressed protein Length = 189 Score = 29.5 bits (63), Expect = 1.7 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 1/86 (1%) Frame = +1 Query: 109 SVTLGSRVSTDAGEDSADDLDESHTDDISRVTDIENETP-SFSEDTFSKDDVFYNASSTS 285 SV + ++ + D SHTD +S + ++TP SF DD F + S S Sbjct: 13 SVLIDEKLEEYSDCDRTATTSRSHTDPVS--SQSTHQTPESFRTPITCDDDTFVSVSGIS 70 Query: 286 LGCAPVIPTSSQYGLAIVGQDNANNQ 363 + +IP +++ + V + AN + Sbjct: 71 RDVSNLIPFATETPASPVQEKMANTR 96 >At2g43650.1 68415.m05425 Sas10/U3 ribonucleoprotein (Utp) family protein contains Pfam profile PF04000: Sas10/Utp3 family; contains Prosite PS00761: Signal peptidases I signature 3; weak similarity to PEBP2 beta-binding protein / charged amino acid rich leucine zipper factor-1 (GI:12061569) [Mus musculus] Length = 654 Score = 29.1 bits (62), Expect = 2.3 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = +1 Query: 151 DSADDLDESHTDDISRVTDIENETPSFSEDTFSKDD 258 D DD DES DD+ V D++ ED ++D+ Sbjct: 43 DVNDDTDESDEDDVQPVFDLQGVDDESEEDEDTEDE 78 >At4g18250.1 68417.m02710 receptor serine/threonine kinase, putative similar to to receptor serine/threonine kinase PR5K gi|1235680|gb|AAC49208 Length = 853 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = -1 Query: 471 FSISYEINNATSTCVSDTDVHIIRFCVITIWH*TS 367 +S + NN+T TC + TD ++I FC +I + TS Sbjct: 411 YSYPFSGNNSTFTCTNSTD-YVITFCPSSIPNTTS 444 >At5g63980.1 68418.m08033 3'(2'),5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase / FIERY1 protein (FRY1) (SAL1) identical to SP|Q42546 3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7) (3'(2'),5- bisphosphonucleoside 3'(2')-phosphohydrolase) (DPNPase) {Arabidopsis thaliana}; identical to cDNA inositol polyphosphate 1-phosphatase FIERY1 (FRY1) GI:15281147 Length = 353 Score = 28.3 bits (60), Expect = 4.0 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 4/44 (9%) Frame = +1 Query: 142 AGEDSADDLDESHTDDISRVTDIENET----PSFSEDTFSKDDV 261 A EDS D + D + R+T + N+T SF+ T S DD+ Sbjct: 70 AEEDSGDLRKDGSQDTLERITKLVNDTLATEESFNGSTLSTDDL 113 >At5g43590.1 68418.m05329 patatin, putative similar to patatin-like latex allergen [Hevea brasiliensis][PMID:10589016]; contains patatin domain PF01734 Length = 401 Score = 28.3 bits (60), Expect = 4.0 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +1 Query: 151 DSADDLDESHTDDISRVTDIENETPSFSEDTFSKDDVFYNASST 282 +S+ D+ + HT + + + E+ DT KD+VF + S T Sbjct: 289 ESSRDMVQYHTSVLFQALESEDNYLRIDADTLKKDEVFMDDSET 332 >At5g07690.1 68418.m00882 myb family transcription factor (MYB29) similar to myb transcription factor GI:3941436 from [Arabidopsis thaliana] Length = 336 Score = 28.3 bits (60), Expect = 4.0 Identities = 25/85 (29%), Positives = 37/85 (43%) Frame = +1 Query: 136 TDAGEDSADDLDESHTDDISRVTDIENETPSFSEDTFSKDDVFYNASSTSLGCAPVIPTS 315 + +G S L S + ++ +T +ETP + SK F +SSTS V + Sbjct: 139 SQSGSISPKSLPPSSSKNVPEITS-SDETPKYDASLSSKKRCFKRSSSTSKLLNKVAARA 197 Query: 316 SQYGLAIVGQDNANNQIGSSVPNSN 390 S G I+G I SS P S+ Sbjct: 198 SSMG-TILGASIEGTLI-SSTPLSS 220 >At3g19020.1 68416.m02415 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 956 Score = 28.3 bits (60), Expect = 4.0 Identities = 23/81 (28%), Positives = 37/81 (45%) Frame = +1 Query: 82 NYCVCEIITSVTLGSRVSTDAGEDSADDLDESHTDDISRVTDIENETPSFSEDTFSKDDV 261 N V + ++ +GS ST +G + + +D S+ VTD + P S TFS + Sbjct: 287 NVTVFDASSNGFVGSLPSTLSGLANVEQMDFSYNKFTGFVTDNICKLPKLSNFTFSYN-- 344 Query: 262 FYNASSTSLGCAPVIPTSSQY 324 F+N + S C P Q+ Sbjct: 345 FFNGEAQS--CVPGSSQEKQF 363 >At5g22650.2 68418.m02647 expressed protein non-consensus AT donor splice site at exon 3, AC acceptor splice site at exon 4; Length = 223 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 148 EDSADDLDESHTDDIS-RVTDIENETPSFSEDTFSKDD 258 ED +DD DES DD S + D++ + E+ S+D+ Sbjct: 74 EDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDE 111 >At5g22650.1 68418.m02646 expressed protein non-consensus AT donor splice site at exon 3, AC acceptor splice site at exon 4; Length = 306 Score = 27.9 bits (59), Expect = 5.3 Identities = 14/38 (36%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +1 Query: 148 EDSADDLDESHTDDIS-RVTDIENETPSFSEDTFSKDD 258 ED +DD DES DD S + D++ + E+ S+D+ Sbjct: 157 EDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDE 194 >At2g47850.1 68415.m05972 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 468 Score = 27.9 bits (59), Expect = 5.3 Identities = 24/73 (32%), Positives = 33/73 (45%), Gaps = 3/73 (4%) Frame = +1 Query: 265 YNASSTSLGCAPV--IPTSSQYG-LAIVGQDNANNQIGSSVPNSNNTEANDMHVSVTNAS 435 YN S++SL APV P SS G LA ++ I ++ T S +N S Sbjct: 367 YNPSASSLADAPVAPYPVSSLLGALAAAPSSSSTELIAGGAKDAYMTGVPTSR-STSNIS 425 Query: 436 AGSIINLIGNAKP 474 AG I + G + P Sbjct: 426 AGLIFSQSGGSIP 438 >At1g56080.1 68414.m06439 expressed protein Length = 310 Score = 27.9 bits (59), Expect = 5.3 Identities = 22/97 (22%), Positives = 39/97 (40%), Gaps = 11/97 (11%) Frame = +1 Query: 145 GEDSADDLDESHTDDISRVTDIENETPSFSE-----------DTFSKDDVFYNASSTSLG 291 G+D + S+ + +S ++ TP FS T + + ASS L Sbjct: 144 GKDENSNGSYSNNEGLSEARQRQSMTPQFSPAFTPSGTPKILSTAASPRSYSAASSPKLF 203 Query: 292 CAPVIPTSSQYGLAIVGQDNANNQIGSSVPNSNNTEA 402 PTSS Y + + + + + +S P S++ A Sbjct: 204 SGAASPTSSHYDIRMWSSTSQQSSVANSPPRSHSVSA 240 >At5g44750.1 68418.m05485 UMUC-like DNA repair family protein / BRCT domain-containing protein low similarity to Rev1S [Homo sapiens] GI:12483635; contains Pfam profiles PF00817: ImpB/MucB/SamB family, PF00533: BRCA1 C Terminus (BRCT) domain Length = 1102 Score = 27.5 bits (58), Expect = 7.0 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +1 Query: 121 GSRVSTDAGEDSADDLDESHTDDISRVTDIENETPSFSEDTFSKD 255 GS + D E++ D +D D+I V IEN TP +E T + D Sbjct: 217 GSSIRADDSEEARDHID----DEIDGVY-IENTTPELTEQTGTGD 256 >At5g17370.1 68418.m02036 WD-40 repeat family protein contains 1 significant, 2 weak WD-40 repeats (PF00400); similar to transducin beta-like 1 protein.(SP:O60907) [Homo sapiens] Length = 467 Score = 27.5 bits (58), Expect = 7.0 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = -2 Query: 572 IHRPLVNGSVLSILTTLKRSFLTCS*ISFIPS*GLAFPMRLIMLPALALVTLTCI 408 +H L NG+++S+ + +FLT I F+ G P +I +P+ +LTC+ Sbjct: 298 VHCGLRNGAIVSVDLRERPAFLTSHNILFLQLQGNINPSHVIYMPS----SLTCL 348 >At5g07980.1 68418.m00928 dentin sialophosphoprotein-related contains weak similarity to Swiss-Prot:Q9NZW4 dentin sialophosphoprotein precursor [Homo sapiens] Length = 1501 Score = 27.5 bits (58), Expect = 7.0 Identities = 14/48 (29%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +1 Query: 310 TSSQYGLAIVGQDNA---NNQIGSSVPNSNNTEANDMHVSVTNASAGS 444 TS +G+A G D+ NN + ++P+ N+ + + + S ++ +AGS Sbjct: 620 TSYGFGIAGAGNDSRHLDNNSLEKAIPHLNSRDGSQILESYSSNNAGS 667 >At5g02460.1 68418.m00173 Dof-type zinc finger domain-containing protein zinc finger protein OBP3, Arabidopsis thaliana, EMBL:AF155818 Length = 399 Score = 27.5 bits (58), Expect = 7.0 Identities = 16/68 (23%), Positives = 33/68 (48%), Gaps = 4/68 (5%) Frame = +1 Query: 184 DDISRVTDIENETPSFSEDT----FSKDDVFYNASSTSLGCAPVIPTSSQYGLAIVGQDN 351 D + +E + P + T + ++F+N S+S + + T++ LA V ++ Sbjct: 289 DPFDQQHQMEQQNPGYGLVTGSGQYRPKNIFHNLISSSSSASSAMVTATASQLASVKMED 348 Query: 352 ANNQIGSS 375 +NNQ+ S Sbjct: 349 SNNQLNLS 356 >At2g39170.1 68415.m04811 expressed protein Length = 231 Score = 27.5 bits (58), Expect = 7.0 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 427 NASAGSIINLIGNAKPQEGMKEIQEHVRNERFKVVKIES 543 N S +I I N +P G+ IQ+H+RN V+ + + Sbjct: 14 NESLAEMIKYIAN-EPSVGLYYIQQHIRNAAPNVINLNN 51 >At5g61960.1 68418.m07777 RNA recognition motif (RRM)-containing protein Mei2-like protein, Arabidopsis thaliana, EMBL:D86122 Length = 915 Score = 27.1 bits (57), Expect = 9.2 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +1 Query: 118 LGSRVSTDAGEDSADDLDESHTDDISRVTDIENETPSFSEDTFSKDD 258 +GS + + G+ + +D ++ IS V++ ETP+ D F K++ Sbjct: 870 MGSNIRSRPGKPRSSSIDNYNSFSISSVSENREETPN-GTDPFLKEN 915 >At4g31430.2 68417.m04465 expressed protein Length = 574 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 118 LGSRVSTDAGEDSADDLDESHTDDISRVTDIENETPSFSED 240 + S V +D+ S +D D S DI D+E P F+E+ Sbjct: 70 ISSVVFSDSSSSSEEDEDSS--SDIDGDEDVEKNNPDFTEE 108 >At4g31430.1 68417.m04464 expressed protein Length = 485 Score = 27.1 bits (57), Expect = 9.2 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 118 LGSRVSTDAGEDSADDLDESHTDDISRVTDIENETPSFSED 240 + S V +D+ S +D D S DI D+E P F+E+ Sbjct: 70 ISSVVFSDSSSSSEEDEDSS--SDIDGDEDVEKNNPDFTEE 108 >At1g64610.2 68414.m07324 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +1 Query: 136 TDAGEDSADDLDESHTDDISRVTDIENETPSFSEDTFSKDDVFYNASSTSLG 291 T +DS D+L+ SHTD +++ +E + S D + N S+TS G Sbjct: 54 TATDDDSEDELEPSHTD-----SNVVSEVVNVSSGVKEIDLLVRNESTTSSG 100 >At1g64610.1 68414.m07323 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 647 Score = 27.1 bits (57), Expect = 9.2 Identities = 17/52 (32%), Positives = 27/52 (51%) Frame = +1 Query: 136 TDAGEDSADDLDESHTDDISRVTDIENETPSFSEDTFSKDDVFYNASSTSLG 291 T +DS D+L+ SHTD +++ +E + S D + N S+TS G Sbjct: 54 TATDDDSEDELEPSHTD-----SNVVSEVVNVSSGVKEIDLLVRNESTTSSG 100 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,092,070 Number of Sequences: 28952 Number of extensions: 240503 Number of successful extensions: 795 Number of sequences better than 10.0: 32 Number of HSP's better than 10.0 without gapping: 772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 793 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -