BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0367 (688 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 25 3.0 AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein p... 25 3.0 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 24 5.2 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 24.6 bits (51), Expect = 3.0 Identities = 13/54 (24%), Positives = 24/54 (44%) Frame = +2 Query: 116 DSSKAKKKRVLPYWFENDVGSNNSGYYRLQAVLTHRGRSSSSGHYVAWVARGAG 277 ++S +++RV+ + D G + YY A L H G + + + G G Sbjct: 266 EASSVEEERVVIFRLPMDGGVPDPSYYTADASLLHHGAKFNKPAHQTPTSSGIG 319 >AB090817-1|BAC57909.1| 344|Anopheles gambiae gag-like protein protein. Length = 344 Score = 24.6 bits (51), Expect = 3.0 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 29 RLTPMRNKFKELEDAKVQSSLSSGNKSHGDSSKAKKKRVLP 151 RLTP+R + + + +++ G+ + K+KKK+ P Sbjct: 73 RLTPVREAVENIPSPRNGPNINEGSINKRKKKKSKKKQNKP 113 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.8 bits (49), Expect = 5.2 Identities = 10/33 (30%), Positives = 15/33 (45%) Frame = +1 Query: 460 TPHSARINKTNKYSYFGHSSAGRKDSVIESCTP 558 TP +++ Y H K S+IE+C P Sbjct: 3093 TPEGEQVHDNTIQRYKSHYKRTSKHSMIENCYP 3125 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 573,937 Number of Sequences: 2352 Number of extensions: 10944 Number of successful extensions: 19 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -