BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0353 (592 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of act... 25 0.63 AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity mod... 25 0.63 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 23 2.6 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 22 4.5 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 4.5 U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 7.8 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 7.8 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 7.8 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 7.8 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 7.8 >AJ888865-1|CAI61930.1| 108|Tribolium castaneum modulator of activity of ets genes protein. Length = 108 Score = 24.6 bits (51), Expect = 0.63 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +3 Query: 51 SDNEDETVPADPEKWDRSDVMRCVRWVAR 137 S ++++ +P DP +W R V + + V + Sbjct: 25 SFDDEDNLPKDPRQWTREHVAQWINLVTQ 53 >AJ622939-1|CAF22091.1| 108|Tribolium castaneum ETS activity modulator protein. Length = 108 Score = 24.6 bits (51), Expect = 0.63 Identities = 8/29 (27%), Positives = 17/29 (58%) Frame = +3 Query: 51 SDNEDETVPADPEKWDRSDVMRCVRWVAR 137 S ++++ +P DP +W R V + + V + Sbjct: 25 SFDDEDNLPKDPRQWTREHVAQWINLVTQ 53 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 22.6 bits (46), Expect = 2.6 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +3 Query: 243 QAGRIYDAYIRHAHAS 290 + GRI+ AY R HAS Sbjct: 303 ELGRIFRAYCRENHAS 318 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.8 bits (44), Expect = 4.5 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +2 Query: 452 GAPGICWEGPPGDGEFRLSDPDEVARRWGRRK 547 G PG + P SDPD + + RR+ Sbjct: 93 GTPGPLSQAPASQQSLDASDPDAMGKWCPRRE 124 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.8 bits (44), Expect = 4.5 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +2 Query: 452 GAPGICWEGPPGDGEFRLSDPDEVARRWGRRK 547 G PG + P SDPD + + RR+ Sbjct: 249 GTPGPLSQAPASQQSLDASDPDAMGKWCPRRE 280 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 327 HQASSSTPSEQLEFQMGMRL 386 HQ S ++PS Q ++G+RL Sbjct: 156 HQDSRTSPSGQHLQELGLRL 175 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 327 HQASSSTPSEQLEFQMGMRL 386 HQ S ++PS Q ++G+RL Sbjct: 156 HQDSRTSPSGQHLQELGLRL 175 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 7.8 Identities = 6/14 (42%), Positives = 6/14 (42%) Frame = -1 Query: 250 PACSSPEHTSVHCC 209 P C P H CC Sbjct: 92 PTCDEPVHRPGRCC 105 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 21.0 bits (42), Expect = 7.8 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +2 Query: 92 MGQKRRDAVREMGGSHLQGGGAAETPAAGHR 184 MG+ V S Q GG T AGH+ Sbjct: 331 MGRHCESKVNFCATSPCQNGGVCTTIHAGHK 361 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.0 bits (42), Expect = 7.8 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 327 HQASSSTPSEQLEFQMGMRL 386 HQ S ++PS Q ++G+RL Sbjct: 156 HQDSRTSPSGQHLQELGLRL 175 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,568 Number of Sequences: 336 Number of extensions: 2690 Number of successful extensions: 12 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14830622 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -