BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0343 (741 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK022138-1|BAB13968.1| 258|Homo sapiens protein ( Homo sapiens ... 33 1.4 BC044240-1|AAH44240.1| 502|Homo sapiens immunoglobulin-like dom... 31 5.7 AY672838-1|AAT77413.1| 514|Homo sapiens immunoglobulin-like dom... 31 5.7 AY672837-1|AAT77412.1| 546|Homo sapiens immunoglobulin-like dom... 31 5.7 AY134857-1|AAN10256.1| 265|Homo sapiens unknown protein. 31 5.7 >AK022138-1|BAB13968.1| 258|Homo sapiens protein ( Homo sapiens cDNA FLJ12076 fis, clone HEMBB1002442, weakly similar to LIN-10 PROTEIN. ). Length = 258 Score = 32.7 bits (71), Expect = 1.4 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 4/42 (9%) Frame = -3 Query: 247 RSVPVYSCCRSRLPCRL---AHCRC-FPRTFHSSHPPTPYSS 134 R+ P CC+S LP RL +H RC F S PPT Y+S Sbjct: 156 RNKPQGRCCQSLLPARLVYVSHFRCQSTMLFSSPPPPTVYNS 197 >BC044240-1|AAH44240.1| 502|Homo sapiens immunoglobulin-like domain containing receptor 1 protein. Length = 502 Score = 30.7 bits (66), Expect = 5.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 238 PVYSCCRSRLPCRLAHCRC 182 P Y CC R PC AHC C Sbjct: 194 PQYCCCYIRCPCCPAHCCC 212 >AY672838-1|AAT77413.1| 514|Homo sapiens immunoglobulin-like domain-containing receptor 1 alpha' protein. Length = 514 Score = 30.7 bits (66), Expect = 5.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 238 PVYSCCRSRLPCRLAHCRC 182 P Y CC R PC AHC C Sbjct: 206 PQYCCCYIRCPCCPAHCCC 224 >AY672837-1|AAT77412.1| 546|Homo sapiens immunoglobulin-like domain-containing receptor 1 alpha protein. Length = 546 Score = 30.7 bits (66), Expect = 5.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 238 PVYSCCRSRLPCRLAHCRC 182 P Y CC R PC AHC C Sbjct: 194 PQYCCCYIRCPCCPAHCCC 212 >AY134857-1|AAN10256.1| 265|Homo sapiens unknown protein. Length = 265 Score = 30.7 bits (66), Expect = 5.7 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -3 Query: 238 PVYSCCRSRLPCRLAHCRC 182 P Y CC R PC AHC C Sbjct: 194 PQYCCCYIRCPCCPAHCCC 212 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,003,293 Number of Sequences: 237096 Number of extensions: 2183999 Number of successful extensions: 8733 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8727 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8847149012 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -