BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0341 (545 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 4.0 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 9.3 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.8 bits (44), Expect = 4.0 Identities = 9/20 (45%), Positives = 12/20 (60%), Gaps = 1/20 (5%) Frame = +3 Query: 105 LYKMVQRTFPP-HHRGTLKW 161 LYK +++ FPP G L W Sbjct: 286 LYKKIKKAFPPLSLHGQLLW 305 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 20.6 bits (41), Expect = 9.3 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +1 Query: 262 DPRRRSRPFPHEHPSQGQRPQGT*GAISSHQ 354 D R+ PH PS P GT G + Q Sbjct: 398 DQSNRAVFSPHAGPSGAYSPDGTMGYMMDGQ 428 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,092 Number of Sequences: 336 Number of extensions: 2808 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -