BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0339 (382 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. 21 4.2 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 4.2 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 4.2 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 20 7.3 AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory recept... 20 7.3 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 20 9.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 20 9.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 20 9.6 >U81040-1|AAB39356.1| 283|Tribolium castaneum TC Deformed protein. Length = 283 Score = 21.0 bits (42), Expect = 4.2 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 207 HTSPPPSLHSMNPPGPSLHCR*NQTTNDTVL 299 H PP LH P SL+ + T++ +L Sbjct: 99 HQIRPPILHDTQPMCESLNTQPPVTSSSNIL 129 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.0 bits (42), Expect = 4.2 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 207 HTSPPPSLHSMNPPGPSLHCR*NQTTNDTVL 299 H PP LH P SL+ + T++ +L Sbjct: 99 HQIRPPILHDTQPMCESLNTQPPVTSSSNIL 129 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.0 bits (42), Expect = 4.2 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +3 Query: 207 HTSPPPSLHSMNPPGPSLHCR*NQTTNDTVL 299 H PP LH P SL+ + T++ +L Sbjct: 99 HQIRPPILHDTQPMCESLNTQPPVTSSSNIL 129 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 20.2 bits (40), Expect = 7.3 Identities = 8/21 (38%), Positives = 10/21 (47%) Frame = +1 Query: 133 PFPCAAEPSRTPSAPRCLRWH 195 PF A+P+ P RWH Sbjct: 383 PFGVMADPAVDLRDPLFFRWH 403 >AM292341-1|CAL23153.2| 393|Tribolium castaneum gustatory receptor candidate 20 protein. Length = 393 Score = 20.2 bits (40), Expect = 7.3 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +2 Query: 212 LASSLPSLDEPSRALSALSLESDDKRYSPVYKFPSITYCQE 334 LA+S+ D LSA L KR+ PVY + + Q+ Sbjct: 147 LAASVIFFDVVVWGLSASDLGVFFKRFLPVYVSYLLIFVQQ 187 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 19.8 bits (39), Expect = 9.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 317 ITYCQETKNDYLY 355 I YCQE D+L+ Sbjct: 74 IFYCQEGSVDFLF 86 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 19.8 bits (39), Expect = 9.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 317 ITYCQETKNDYLY 355 I YCQE D+L+ Sbjct: 307 IFYCQEGSVDFLF 319 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 19.8 bits (39), Expect = 9.6 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +2 Query: 317 ITYCQETKNDYLY 355 I YCQE D+L+ Sbjct: 307 IFYCQEGSVDFLF 319 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,835 Number of Sequences: 336 Number of extensions: 2009 Number of successful extensions: 8 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 7908675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -