BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0339 (382 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL731868-5|CAI40828.1| 244|Homo sapiens myeloid/lymphoid or mix... 33 0.41 AL731868-4|CAI40827.1| 184|Homo sapiens myeloid/lymphoid or mix... 33 0.41 AL009178-5|CAI20904.1| 244|Homo sapiens myeloid/lymphoid or mix... 33 0.41 AL009178-4|CAI20903.1| 184|Homo sapiens myeloid/lymphoid or mix... 33 0.41 AY152396-1|AAN73051.1| 1288|Homo sapiens synaptojanin 2A protein. 32 0.54 BC043277-1|AAH43277.1| 839|Homo sapiens SYNJ2 protein protein. 31 1.2 AL139330-4|CAI12983.1| 1496|Homo sapiens synaptojanin 2 protein. 31 1.2 AL139330-1|CAI12978.1| 581|Homo sapiens synaptojanin 2 protein. 31 1.2 AF318616-1|AAG46036.1| 1496|Homo sapiens synaptojanin 2 protein. 31 1.2 AF039945-1|AAD02178.1| 1443|Homo sapiens synaptojanin 2B protein. 31 1.2 AB002346-1|BAA20805.2| 1443|Homo sapiens KIAA0348 protein protein. 31 1.2 U02478-1|AAC50059.1| 1612|Homo sapiens AF-6 protein. 30 2.9 AL731868-3|CAI40826.1| 1612|Homo sapiens myeloid/lymphoid or mix... 30 2.9 AL731868-2|CAI40825.1| 1665|Homo sapiens myeloid/lymphoid or mix... 30 2.9 AL731868-1|CAI40824.1| 1824|Homo sapiens myeloid/lymphoid or mix... 30 2.9 AL049698-3|CAI42814.1| 1612|Homo sapiens myeloid/lymphoid or mix... 30 2.9 AL049698-2|CAI42813.1| 1665|Homo sapiens myeloid/lymphoid or mix... 30 2.9 AL049698-1|CAI42812.1| 1824|Homo sapiens myeloid/lymphoid or mix... 30 2.9 AL009178-3|CAI20902.1| 1612|Homo sapiens myeloid/lymphoid or mix... 30 2.9 AL009178-2|CAI20901.1| 1665|Homo sapiens myeloid/lymphoid or mix... 30 2.9 AL009178-1|CAI20900.1| 1824|Homo sapiens myeloid/lymphoid or mix... 30 2.9 AB209420-1|BAD92657.1| 1639|Homo sapiens Afadin variant protein. 30 2.9 AB011399-3|BAA32485.1| 1611|Homo sapiens AF-6 protein. 30 2.9 AB011399-2|BAA32484.1| 1816|Homo sapiens AF-6 protein. 30 2.9 AB011399-1|BAA32483.1| 1743|Homo sapiens AF-6 protein. 30 2.9 Y13440-1|CAA73851.1| 582|Homo sapiens Rox protein. 29 5.0 X96401-1|CAA65265.1| 582|Homo sapiens ROX protein protein. 29 5.0 BC117563-1|AAI17564.1| 582|Homo sapiens MAX binding protein pro... 29 5.0 AL360295-1|CAH73130.1| 728|Homo sapiens chromosome 1 open readi... 29 5.0 AL035705-1|CAI22671.1| 728|Homo sapiens chromosome 1 open readi... 29 5.0 AK125198-1|BAC86080.1| 358|Homo sapiens protein ( Homo sapiens ... 29 5.0 AF258550-1|AAG23753.1| 116|Homo sapiens PP13 protein. 29 5.0 AK096260-1|BAC04742.1| 198|Homo sapiens protein ( Homo sapiens ... 29 6.6 AJ007421-1|CAB65124.1| 1272|Homo sapiens spalt-like zinc finger ... 29 6.6 AF347021-1|AAK18311.1| 1300|Homo sapiens C2H2 zinc finger protei... 29 6.6 AF173358-1|AAF36536.1| 334|Homo sapiens glucocorticoid receptor... 29 6.6 >AL731868-5|CAI40828.1| 244|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 244 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E ER+L D+ PL+VQ W Sbjct: 87 KYSLYEVHVSGE-ERRLDIDEKPLVVQLNW 115 >AL731868-4|CAI40827.1| 184|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 184 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E ER+L D+ PL+VQ W Sbjct: 72 KYSLYEVHVSGE-ERRLDIDEKPLVVQLNW 100 >AL009178-5|CAI20904.1| 244|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 244 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E ER+L D+ PL+VQ W Sbjct: 87 KYSLYEVHVSGE-ERRLDIDEKPLVVQLNW 115 >AL009178-4|CAI20903.1| 184|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 184 Score = 32.7 bits (71), Expect = 0.41 Identities = 16/30 (53%), Positives = 22/30 (73%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E ER+L D+ PL+VQ W Sbjct: 72 KYSLYEVHVSGE-ERRLDIDEKPLVVQLNW 100 >AY152396-1|AAN73051.1| 1288|Homo sapiens synaptojanin 2A protein. Length = 1288 Score = 32.3 bits (70), Expect = 0.54 Identities = 22/65 (33%), Positives = 29/65 (44%) Frame = +1 Query: 133 PFPCAAEPSRTPSAPRCLRWHPTCRTPRLLPPFTR*TLPGPLCTVVRIRRQTIQSCIQIP 312 P P AA+P TP AP L P R P + P R T C+ R Q Q C+ + Sbjct: 1211 PTPGAAKPE-TPQAPPLLPRRPPPRVPAIKKPTLRRTGKIVFCS----RSQASQPCLLLQ 1265 Query: 313 KHNIL 327 +H + Sbjct: 1266 RHEFV 1270 >BC043277-1|AAH43277.1| 839|Homo sapiens SYNJ2 protein protein. Length = 839 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/64 (34%), Positives = 30/64 (46%) Frame = +1 Query: 133 PFPCAAEPSRTPSAPRCLRWHPTCRTPRLLPPFTR*TLPGPLCTVVRIRRQTIQSCIQIP 312 P P AA+P TP AP L P R P + P R T PL + +QT+ I P Sbjct: 554 PTPGAAKPE-TPQAPPLLPRRPPPRVPAIKKPTLRRT-GKPLSPEEQFEQQTVHFTIGPP 611 Query: 313 KHNI 324 + ++ Sbjct: 612 ETSV 615 >AL139330-4|CAI12983.1| 1496|Homo sapiens synaptojanin 2 protein. Length = 1496 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/64 (34%), Positives = 30/64 (46%) Frame = +1 Query: 133 PFPCAAEPSRTPSAPRCLRWHPTCRTPRLLPPFTR*TLPGPLCTVVRIRRQTIQSCIQIP 312 P P AA+P TP AP L P R P + P R T PL + +QT+ I P Sbjct: 1211 PTPGAAKPE-TPQAPPLLPRRPPPRVPAIKKPTLRRT-GKPLSPEEQFEQQTVHFTIGPP 1268 Query: 313 KHNI 324 + ++ Sbjct: 1269 ETSV 1272 >AL139330-1|CAI12978.1| 581|Homo sapiens synaptojanin 2 protein. Length = 581 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/64 (34%), Positives = 30/64 (46%) Frame = +1 Query: 133 PFPCAAEPSRTPSAPRCLRWHPTCRTPRLLPPFTR*TLPGPLCTVVRIRRQTIQSCIQIP 312 P P AA+P TP AP L P R P + P R T PL + +QT+ I P Sbjct: 296 PTPGAAKPE-TPQAPPLLPRRPPPRVPAIKKPTLRRT-GKPLSPEEQFEQQTVHFTIGPP 353 Query: 313 KHNI 324 + ++ Sbjct: 354 ETSV 357 >AF318616-1|AAG46036.1| 1496|Homo sapiens synaptojanin 2 protein. Length = 1496 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/64 (34%), Positives = 30/64 (46%) Frame = +1 Query: 133 PFPCAAEPSRTPSAPRCLRWHPTCRTPRLLPPFTR*TLPGPLCTVVRIRRQTIQSCIQIP 312 P P AA+P TP AP L P R P + P R T PL + +QT+ I P Sbjct: 1211 PTPGAAKPE-TPQAPPLLPRRPPPRVPAIKKPTLRRT-GKPLSPEEQFEQQTVHFTIGPP 1268 Query: 313 KHNI 324 + ++ Sbjct: 1269 ETSV 1272 >AF039945-1|AAD02178.1| 1443|Homo sapiens synaptojanin 2B protein. Length = 1443 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/64 (34%), Positives = 30/64 (46%) Frame = +1 Query: 133 PFPCAAEPSRTPSAPRCLRWHPTCRTPRLLPPFTR*TLPGPLCTVVRIRRQTIQSCIQIP 312 P P AA+P TP AP L P R P + P R T PL + +QT+ I P Sbjct: 1158 PTPGAAKPE-TPQAPPLLPRRPPPRVPAIKKPTLRRT-GKPLSPEEQFEQQTVHFTIGPP 1215 Query: 313 KHNI 324 + ++ Sbjct: 1216 ETSV 1219 >AB002346-1|BAA20805.2| 1443|Homo sapiens KIAA0348 protein protein. Length = 1443 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/64 (34%), Positives = 30/64 (46%) Frame = +1 Query: 133 PFPCAAEPSRTPSAPRCLRWHPTCRTPRLLPPFTR*TLPGPLCTVVRIRRQTIQSCIQIP 312 P P AA+P TP AP L P R P + P R T PL + +QT+ I P Sbjct: 1158 PTPGAAKPE-TPQAPPLLPRRPPPRVPAIKKPTLRRT-GKPLSPEEQFEQQTVHFTIGPP 1215 Query: 313 KHNI 324 + ++ Sbjct: 1216 ETSV 1219 >U02478-1|AAC50059.1| 1612|Homo sapiens AF-6 protein. Length = 1612 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AL731868-3|CAI40826.1| 1612|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 1612 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AL731868-2|CAI40825.1| 1665|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 1665 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AL731868-1|CAI40824.1| 1824|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 1824 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AL049698-3|CAI42814.1| 1612|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 1612 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AL049698-2|CAI42813.1| 1665|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 1665 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AL049698-1|CAI42812.1| 1824|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 1824 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AL009178-3|CAI20902.1| 1612|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 1612 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AL009178-2|CAI20901.1| 1665|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 1665 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AL009178-1|CAI20900.1| 1824|Homo sapiens myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); tra protein. Length = 1824 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AB209420-1|BAD92657.1| 1639|Homo sapiens Afadin variant protein. Length = 1639 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 78 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 105 >AB011399-3|BAA32485.1| 1611|Homo sapiens AF-6 protein. Length = 1611 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AB011399-2|BAA32484.1| 1816|Homo sapiens AF-6 protein. Length = 1816 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >AB011399-1|BAA32483.1| 1743|Homo sapiens AF-6 protein. Length = 1743 Score = 29.9 bits (64), Expect = 2.9 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 26 RFSLYEVYPSQEYERKLHPDDLPLLVQRAW 115 ++SLYEV+ S E R+L D+ PL+VQ W Sbjct: 90 KYSLYEVHVSGE--RRLDIDEKPLVVQLNW 117 >Y13440-1|CAA73851.1| 582|Homo sapiens Rox protein. Length = 582 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +1 Query: 82 RRSALIGATGLAP*ERLPFPCAAE-PSRTPSAPRCLRWHPTCRTPRLLPPFTR*TLPGPL 258 R+ AL+GA GL+ E P P + P+ P P P +P+ L P LP P+ Sbjct: 119 RQPALVGAPGLSIKEPAPLPSRPQVPTPAPLLPDSKATIPPNGSPKPLQP-----LPTPV 173 Query: 259 CTV 267 T+ Sbjct: 174 LTI 176 >X96401-1|CAA65265.1| 582|Homo sapiens ROX protein protein. Length = 582 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +1 Query: 82 RRSALIGATGLAP*ERLPFPCAAE-PSRTPSAPRCLRWHPTCRTPRLLPPFTR*TLPGPL 258 R+ AL+GA GL+ E P P + P+ P P P +P+ L P LP P+ Sbjct: 119 RQPALVGAPGLSIKEPAPLPSRPQVPTPAPLLPDSKATIPPNGSPKPLQP-----LPTPV 173 Query: 259 CTV 267 T+ Sbjct: 174 LTI 176 >BC117563-1|AAI17564.1| 582|Homo sapiens MAX binding protein protein. Length = 582 Score = 29.1 bits (62), Expect = 5.0 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Frame = +1 Query: 82 RRSALIGATGLAP*ERLPFPCAAE-PSRTPSAPRCLRWHPTCRTPRLLPPFTR*TLPGPL 258 R+ AL+GA GL+ E P P + P+ P P P +P+ L P LP P+ Sbjct: 119 RQPALVGAPGLSIKEPAPLPSRPQVPTPAPLLPDSKATIPPNGSPKPLQP-----LPTPV 173 Query: 259 CTV 267 T+ Sbjct: 174 LTI 176 >AL360295-1|CAH73130.1| 728|Homo sapiens chromosome 1 open reading frame 168 protein. Length = 728 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 198 HMPHTSPPPSLHSMNPPGP 254 H+P T P PS+ S+ PP P Sbjct: 262 HLPKTKPLPSIDSLGPPPP 280 >AL035705-1|CAI22671.1| 728|Homo sapiens chromosome 1 open reading frame 168 protein. Length = 728 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 198 HMPHTSPPPSLHSMNPPGP 254 H+P T P PS+ S+ PP P Sbjct: 262 HLPKTKPLPSIDSLGPPPP 280 >AK125198-1|BAC86080.1| 358|Homo sapiens protein ( Homo sapiens cDNA FLJ43208 fis, clone FEBRA2014213. ). Length = 358 Score = 29.1 bits (62), Expect = 5.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 198 HMPHTSPPPSLHSMNPPGP 254 H+P T P PS+ S+ PP P Sbjct: 262 HLPKTKPLPSIDSLGPPPP 280 >AF258550-1|AAG23753.1| 116|Homo sapiens PP13 protein. Length = 116 Score = 29.1 bits (62), Expect = 5.0 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +1 Query: 115 AP*ERLPFPCAAEPSRTPSAPRCLRWHPTCRTP 213 +P R P P A P R SAP CL+W P RTP Sbjct: 50 SPGIRTPGPSA--PERPGSAPGCLQWAPG-RTP 79 >AK096260-1|BAC04742.1| 198|Homo sapiens protein ( Homo sapiens cDNA FLJ38941 fis, clone NT2NE2015974. ). Length = 198 Score = 28.7 bits (61), Expect = 6.6 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +3 Query: 210 TSPPPSLHSMNP-PGPSLHC 266 T PPPSL S+ P PGP C Sbjct: 162 TGPPPSLSSLGPRPGPPWRC 181 >AJ007421-1|CAB65124.1| 1272|Homo sapiens spalt-like zinc finger protein protein. Length = 1272 Score = 28.7 bits (61), Expect = 6.6 Identities = 28/78 (35%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +1 Query: 49 SIPRIRAKAPSRRSA-LIGATGLA-P*ERLPFPCAAEPSRTPSAPRCLRWHPTCRTPRLL 222 S P RA++ + A GA G A P E+ P AEP+ APR P TP Sbjct: 73 SSPSERAESEAAEEAGAEGAEGEARPVEKEAEPMDAEPAGDTRAPRPPPAAPAPPTPAYG 132 Query: 223 PPFTR*TLPGPLCTVVRI 276 P T TL L T V + Sbjct: 133 APSTNVTLEALLSTKVAV 150 >AF347021-1|AAK18311.1| 1300|Homo sapiens C2H2 zinc finger protein protein. Length = 1300 Score = 28.7 bits (61), Expect = 6.6 Identities = 28/78 (35%), Positives = 34/78 (43%), Gaps = 2/78 (2%) Frame = +1 Query: 49 SIPRIRAKAPSRRSA-LIGATGLA-P*ERLPFPCAAEPSRTPSAPRCLRWHPTCRTPRLL 222 S P RA++ + A GA G A P E+ P AEP+ APR P TP Sbjct: 101 SSPSERAESEAAEEAGAEGAEGEARPVEKEAEPMDAEPAGDTRAPRPPPAAPAPPTPAYG 160 Query: 223 PPFTR*TLPGPLCTVVRI 276 P T TL L T V + Sbjct: 161 APSTNVTLEALLSTKVAV 178 >AF173358-1|AAF36536.1| 334|Homo sapiens glucocorticoid receptor AF-1 coactivator-1 protein. Length = 334 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +1 Query: 109 GLAP*ERLPFPCAAEPSRTPSAPRCLRWHPTC 204 G P E P P P + + PR LR HP C Sbjct: 283 GPRPAEVPPIPVFCLPQQPVAVPRALRQHPVC 314 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 59,920,523 Number of Sequences: 237096 Number of extensions: 1419498 Number of successful extensions: 5448 Number of sequences better than 10.0: 36 Number of HSP's better than 10.0 without gapping: 5004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5404 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2526356360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -