BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0330 (687 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 26 0.33 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 24 1.0 AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 22 4.1 AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc fin... 22 5.4 DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 21 7.2 AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory recept... 21 7.2 AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory recept... 21 7.2 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 25.8 bits (54), Expect = 0.33 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = +3 Query: 477 RVSIMNELDSLRQEAETLKNAIRDARKAACDTSLAQATSNLEPIGRIQMRTRRTLRGHLA 656 R ++N +D L +ETL + R+ A+ T NLE IQ + GH+ Sbjct: 451 REFVVNYIDDLLVASETLNEHLEHLRQVFEKLKQARMTINLEKSNFIQKEVK--FLGHIL 508 Query: 657 KI 662 I Sbjct: 509 TI 510 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 24.2 bits (50), Expect = 1.0 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -1 Query: 633 VGCASVCDRSAPGSRWPGPATCRMPLSSHL 544 V V + G R PGPA R L +HL Sbjct: 316 VAAVQVPQLAGGGRRGPGPARSRRHLPAHL 345 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/31 (29%), Positives = 14/31 (45%) Frame = +2 Query: 581 PGHLEPGADRSHTDAHPTNLARSSREDLRHA 673 P H P +D+ H H T + ++ D A Sbjct: 32 PRHFNPPSDKLHHPIHQTVIYHNNPRDPNRA 62 >AY316682-1|AAQ83696.1| 456|Tribolium castaneum Sp-like zinc finger protein protein. Length = 456 Score = 21.8 bits (44), Expect = 5.4 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = +2 Query: 593 EPGADRSHTDAHPTNLARSSREDLRHALG 679 +P D SH H T+L H LG Sbjct: 126 QPPTDNSHVHHHQTSLLGKVEGAATHHLG 154 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = +3 Query: 492 NELDSLRQEAETLKNAIR 545 +++ +LRQE ETLK+ ++ Sbjct: 344 DKIVALRQEQETLKSQVQ 361 >AM292339-1|CAL23151.2| 387|Tribolium castaneum gustatory receptor candidate 18 protein. Length = 387 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 483 SIMNELDSLRQEAETLKNAI 542 +I N +DS+RQ ++T A+ Sbjct: 193 AINNIIDSIRQNSQTRNQAV 212 >AM292338-1|CAL23150.2| 372|Tribolium castaneum gustatory receptor candidate 17 protein. Length = 372 Score = 21.4 bits (43), Expect = 7.2 Identities = 8/20 (40%), Positives = 14/20 (70%) Frame = +3 Query: 483 SIMNELDSLRQEAETLKNAI 542 +I N +DS+RQ ++T A+ Sbjct: 193 AINNIIDSIRQNSQTRNQAV 212 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,740 Number of Sequences: 336 Number of extensions: 3648 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18010165 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -