BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0330 (687 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse tra... 23 6.8 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 23 6.8 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 23 6.8 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 23 6.8 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 23 6.8 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 23 6.8 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 23 6.8 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 23 6.8 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 23 6.8 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 23 6.8 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 23 6.8 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 23 6.8 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 23 6.8 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 23 6.8 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 23 6.8 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 23 6.8 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 23 6.8 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 23 6.8 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 23 6.8 AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. 23 9.0 AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled ... 23 9.0 AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein... 23 9.0 >U03849-2|AAA53489.1| 1049|Anopheles gambiae putative reverse transcriptase protein. Length = 1049 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +3 Query: 372 RRSKGHC*QKDRCVACCTCAAR 437 RRS HC Q+ R +C AA+ Sbjct: 38 RRSSAHCTQQTRQASCSDNAAQ 59 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 27 SSLKQALASLRQSAWNV 43 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 23.4 bits (48), Expect = 6.8 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 211 SVLFTAICKLRQSSWNV 161 S L A+ LRQS+WNV Sbjct: 42 SSLKQALASLRQSAWNV 58 >AY578811-1|AAT07316.1| 565|Anopheles gambiae thickveins protein. Length = 565 Score = 23.0 bits (47), Expect = 9.0 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 359 KIAGASIEGTLLTEGSVRCVLYVRGARLSIVC 454 K+A G + E + RC+ VRGA+ + C Sbjct: 451 KMADMYSVGLVFWEMARRCITTVRGAKNTTTC 482 >AY301275-1|AAQ67361.1| 611|Anopheles gambiae G-protein coupled receptor protein. Length = 611 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -3 Query: 235 LAFHTPSRSVLFTAICKLRQSSWNVIGVFCAGEV 134 L FH VL T C + +++W + AG + Sbjct: 221 LIFHLSIADVLVTGFCLIGEAAWYYTVDWVAGNL 254 >AJ439353-2|CAD27924.1| 612|Anopheles gambiae putative G-protein coupled receptor protein. Length = 612 Score = 23.0 bits (47), Expect = 9.0 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -3 Query: 235 LAFHTPSRSVLFTAICKLRQSSWNVIGVFCAGEV 134 L FH VL T C + +++W + AG + Sbjct: 222 LIFHLSIADVLVTGFCLIGEAAWYYTVDWVAGNL 255 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 757,187 Number of Sequences: 2352 Number of extensions: 17466 Number of successful extensions: 103 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 103 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69413730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -