BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0314 (430 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 25 1.5 AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. 24 2.0 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 24 2.6 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 22 8.0 AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 22 8.0 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 24.6 bits (51), Expect = 1.5 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +1 Query: 289 PPKPPLGGVKISSKDGSKVTTVVATPGQGPDRTQEVS 399 PP G++ S DG+K+TT V RT E S Sbjct: 61 PPSVQAEGLRGSETDGAKLTTAVGGRLSYLTRTDEPS 97 >AY846632-1|AAW31598.1| 412|Anopheles gambiae SAGLIN protein. Length = 412 Score = 24.2 bits (50), Expect = 2.0 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 351 CGSDAGAGP*PDSGSELC*HEID 419 C A AGP PD S+ C +D Sbjct: 80 CQERAAAGPAPDPSSQFCQQLLD 102 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 23.8 bits (49), Expect = 2.6 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = +1 Query: 277 FDNQPPKPPLGGVKISSKDGSKVTTVVATPGQ 372 F N P+ GV+ S GS+ V PGQ Sbjct: 77 FRNPVPRARWTGVRDGSNHGSECLQVSVVPGQ 108 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 22.2 bits (45), Expect = 8.0 Identities = 15/50 (30%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = +1 Query: 226 RPRTTSFAEGSKSVRKTFDNQPPKPP--LGGVKISSKDGSKVT-TVVATP 366 RPR S + K D+ P +PP G V +S + ++ T++A P Sbjct: 37 RPRARSVSLNRVDALKVSDSTPVEPPPTAGIVYLSDDEEEELNCTILAGP 86 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 22.2 bits (45), Expect = 8.0 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -2 Query: 81 HYYEIKNQNKIVPLQNY 31 HYY + +QN V +++Y Sbjct: 147 HYYPLDSQNCTVEIESY 163 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 384,007 Number of Sequences: 2352 Number of extensions: 6462 Number of successful extensions: 13 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35292513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -