BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0306 (420 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless prot... 22 2.8 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 22 2.8 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 3.7 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 20 8.5 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 20 8.5 >AF225975-2|AAF74116.1| 302|Tribolium castaneum Tc-tailless protein. Length = 302 Score = 21.8 bits (44), Expect = 2.8 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -2 Query: 260 VGLHLDFLSDKSGLRQSCYSAYYSNSYFRNSNIL 159 VG++ D + + G R S +SY+ S ++ Sbjct: 103 VGMNKDAVQHERGPRNSTLRRQQMSSYYNESRVM 136 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.8 bits (44), Expect = 2.8 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -2 Query: 260 VGLHLDFLSDKSGLRQSCYSAYYSNSYFRNSNIL 159 VG++ D + + G R S +SY+ S ++ Sbjct: 103 VGMNKDAVQHERGPRNSTLRRQQMSSYYNESRVM 136 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 3.7 Identities = 6/10 (60%), Positives = 9/10 (90%) Frame = -1 Query: 372 FFINWSQFRV 343 ++ NWSQ+RV Sbjct: 92 YYTNWSQYRV 101 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 20.2 bits (40), Expect = 8.5 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +2 Query: 242 SQDEVLPNQPRQARNLQGLL 301 SQD + + RN+QGLL Sbjct: 282 SQDPSISSTETLLRNIQGLL 301 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 20.2 bits (40), Expect = 8.5 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -3 Query: 376 VFLHQLVPIPSSLVHLQLLWL 314 + + + +P+P LV Q +WL Sbjct: 448 MLIKETMPLPRKLVRGQDVWL 468 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 88,462 Number of Sequences: 336 Number of extensions: 1646 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 9279512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -