BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Nnor0306 (420 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.3 >SB_12315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 528 Score = 27.9 bits (59), Expect = 3.6 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +2 Query: 308 EWKPQKLKMHQGTRNWDQLMKKDAXSLK 391 EWKPQK+ + T N Q K+ + S K Sbjct: 348 EWKPQKVSKQKQTTNNKQFSKESSSSSK 375 >SB_47621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 591 Score = 26.6 bits (56), Expect = 8.3 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 2/55 (3%) Frame = -2 Query: 329 SAFVASIQTVKVLAGFLPASADLVGLHLDFLSDKSGLRQSCYS-AYYSN-SYFRN 171 S+ A + V++L ++ D+ GLH D ++ S SC S + SN S+F+N Sbjct: 140 SSSPALVSDVRILPVYMYDKMDVEGLHRDAMTLASEFFSSCESRSVESNWSHFKN 194 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,233,463 Number of Sequences: 59808 Number of extensions: 198979 Number of successful extensions: 405 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 380 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 405 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -